DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STX7 and Syx17

DIOPT Version :9

Sequence 1:NP_001313507.1 Gene:STX7 / 8417 HGNCID:11442 Length:261 Species:Homo sapiens
Sequence 2:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster


Alignment Length:236 Identity:47/236 - (19%)
Similarity:96/236 - (40%) Gaps:49/236 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    25 ITQCSVEIQRTLNQLGTPQDSPELR---------------QQLQQKQQYTNQLAKETDKYIKEFG 74
            :.|..|.||| ...:..|.....|:               |::::::....::.|:....:.|..
  Fly     9 LKQAEVSIQR-FQDVAVPHHLSLLKNHRSNIEKSLALGDWQKIKKEELNAMRVIKQIKNLLLEMD 72

Human    75 SLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAERE----KEFVARVRAS--SRVSGSFP 133
            :|        :.|::::        .|..|..:.:...:..    |||......|  |.:|..:.
  Fly    73 AL--------REKVREE--------DLERFDDLMKPGRDTAFAGMKEFAELQLKSPTSTLSSQYD 121

Human   134 EDSSKERNLVSWES----QTQPQVQVQDEEITEDDLRLIHERESSIRQLE---ADIMDINEIFKD 191
            :|...:...|...|    :..||:|: :.::.|..|.   :|::.:.|:|   .:|.|::.:|:.
  Fly   122 DDLDNQPQEVDMNSLPAHRHMPQLQL-NFQLEEHQLA---QRQACLDQMENLQQEIYDLHGMFQG 182

Human   192 LGMMIHEQGDVIDSIEANVENAEVHVQQANQQLSRAADYQR 232
            :..:..||...::.|..|.|.|..:|||....|.||..|::
  Fly   183 MRQLTAEQSVAVEKIADNAEEALENVQQGELNLRRALTYKK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STX7NP_001313507.1 Syntaxin_2 18..119 CDD:373109 16/112 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..148 4/22 (18%)
SNARE_syntaxin7 168..227 CDD:277228 16/61 (26%)
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.