DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARL6 and dnd

DIOPT Version :9

Sequence 1:NP_001310442.1 Gene:ARL6 / 84100 HGNCID:13210 Length:193 Species:Homo sapiens
Sequence 2:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster


Alignment Length:193 Identity:69/193 - (35%)
Similarity:114/193 - (59%) Gaps:14/193 - (7%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSF 65
            ||||..|..|....:||..:|.|||||:|||||:.:|  ::.....:.||.||:|:...:.....
  Fly     1 MGLLSLLRKLRPNPEKEARILLLGLDNAGKTTILKQL--ASEDITTVTPTAGFNIKSVAADGFKL 63

Human    66 TVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFAN 130
            .|:|:.||.:.|..|::|:.....:|:|||.:||.|:..|..||..:|  .|.:.:::|:|.|||
  Fly    64 NVWDIGGQWKIRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEML--MDNRLKQVPVLIFAN 126

Human   131 KMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQEKTIQSDPDCEDMKR 193
            |.|:.||:::.:|::.:.|..::.:.|.|.|..|:.|.||:||:||:          |::||:
  Fly   127 KQDMPDAMSAAEVAEKMSLVQLQGRTWEIKACTAVDGTGLKEGMDWV----------CKNMKK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARL6NP_001310442.1 Arl6 19..180 CDD:206722 58/160 (36%)
dndNP_650995.1 Arl3 3..176 CDD:206721 65/186 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.