DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARL6 and Arl5

DIOPT Version :9

Sequence 1:NP_001310442.1 Gene:ARL6 / 84100 HGNCID:13210 Length:193 Species:Homo sapiens
Sequence 2:NP_648201.1 Gene:Arl5 / 38931 FlyBaseID:FBgn0035866 Length:179 Species:Drosophila melanogaster


Alignment Length:181 Identity:70/181 - (38%)
Similarity:110/181 - (60%) Gaps:7/181 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGLLDRLSVLLGLKKKEVHVLCL-GLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLS 64
            ||||  ||.|..:...|.|.|.: ||||:|||||:.:...:.....:  ||||.::|:....::.
  Fly     1 MGLL--LSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTS--PTIGSNVEEVVWRNIH 61

Human    65 FTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFA 129
            |.|:|:.||...|..|..||...:.:|.||||:||.|:.|.:|||..:|.|.|:.  :..:|.:|
  Fly    62 FLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLAVTREELYRMLQHEDLS--KASLLVYA 124

Human   130 NKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQEK 180
            ||.||:.::::.::|:.|.|.:||...|||.|..|:.||||.:|::|:.::
  Fly   125 NKQDLKGSMSAAEISRQLDLTSIKKHQWHIQACCALTGEGLYQGLEWIVQR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARL6NP_001310442.1 Arl6 19..180 CDD:206722 62/161 (39%)
Arl5NP_648201.1 Arl5_Arl8 3..175 CDD:133353 68/177 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.