DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP8 and Strica

DIOPT Version :9

Sequence 1:NP_001073594.1 Gene:CASP8 / 841 HGNCID:1509 Length:538 Species:Homo sapiens
Sequence 2:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster


Alignment Length:332 Identity:93/332 - (28%)
Similarity:138/332 - (41%) Gaps:69/332 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   218 ILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEF----SNGEELCGVMTISDSPREQDSES 278
            |.|....|::|.|                |...:|..|    |:|.....|..::.|...|.:.|
  Fly   247 IFKSAPKQVDKPL----------------SSTATPKPFISLGSSGGTKPKVTAVAQSQDAQGTIS 295

Human   279 QTL----DKVYQMKSKP-RGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHF 338
            .:|    ..:.:.|.|| |.|  |.|:..|....|         .|.|:..|...|..|||:|..
  Fly   296 TSLGISKSSLTKNKLKPARVY--IFNHERFDNKNE---------FRKGSAQDVKVLRATFEQLKC 349

Human   339 EIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDK-GIIYGTDGQEAPIYELTSQ--FT 400
            :::...|.|:..|.:.:::.|..|..:....:..|||||.: ..|...|..    |.|...  |.
  Fly   350 KVEVITDATLVTIKKTVRMLQTKDFEDKSALVLVILSHGTRHDQIAAKDDD----YSLDDDVVFP 410

Human   401 GLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATV 465
            .|:..:|..|||:.|:|||:||....|.  .||: .||.     .||.        :.|...:|.
  Fly   411 ILRNRTLKDKPKLIFVQACKGDCQLGGF--MTDA-AQPN-----GSPN--------EILKCYSTY 459

Human   466 NNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVN--YEVSNKDDKKNMGKQMPQPTFT 528
            ...||:|. .:||.:||:||::| .|..:..||.||:..|.  .::.:||      :|:|..|.|
  Fly   460 EGFVSFRT-EDGTPFIQTLCEAL-NRSGKTSDIDTIMMNVRQVVKMQSKD------RQIPSVTST 516

Human   529 LRKKLVF 535
            |..|.||
  Fly   517 LTSKYVF 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP8NP_001073594.1 DED_Caspase_8_r1 62..143 CDD:260041
DD 157..239 CDD:301326 5/20 (25%)
CASc 284..536 CDD:237997 78/258 (30%)
StricaNP_001260718.1 CASc 311..523 CDD:294037 75/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.