DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ULK1 and Aduk

DIOPT Version :9

Sequence 1:XP_011537100.1 Gene:ULK1 / 8408 HGNCID:12558 Length:1073 Species:Homo sapiens
Sequence 2:NP_731331.1 Gene:Aduk / 41112 FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster


Alignment Length:269 Identity:109/269 - (40%)
Similarity:166/269 - (61%) Gaps:14/269 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    14 FEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAK-SQTLLGKEIKILKELKHENIVA 77
            ||...|  :|.|::|.|:|.||:::.... |:|.:....|:: |:..|..||::|:||||:.||.
  Fly     9 FEILEK--LGAGSYATVYKARHKKQRTYH-AIKYVEMSTLSQTSRENLITEIRLLRELKHKYIVT 70

Human    78 LYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQQIAGAMRLLHSKGIIHRDLKPQ 142
            |.||.....::|:|:||||.|:|:.::...:.|.|.|.|.||:|:|.|::.:.:..:.|.|||||
  Fly    71 LQDFFWDDKNIYIVLEYCNAGNLSAFIRTKKALPESTCRYFLRQLAAAVQYMRANDVSHFDLKPQ 135

Human   143 NILLSNPAGRRANPNSIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSI 207
            |:||:..|      |::.:|:||||||::|:...:...|.|||:|||||::....||.|||||||
  Fly   136 NLLLTRGA------NNVSLKVADFGFAQHLKLGEINQQLKGSPLYMAPEIVRKHQYDAKADLWSI 194

Human   208 GTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLVPTIP--RETSAPLRQLLLALLQRNHKDRMDFD 270
            |.|:|:||.||||:.:.:.::|.|...|.:.:  |:|  ...|.....||..||......|:.|.
  Fly   195 GVILYECLFGKAPYSSRTIEELLLRIRKAEAI--TLPPNARISNECHDLLRRLLAHEPTARISFA 257

Human   271 EFFHHPFLD 279
            :||.|||||
  Fly   258 DFFAHPFLD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ULK1XP_011537100.1 STKc_ULK1 13..279 CDD:271104 107/267 (40%)
S_TKc 16..278 CDD:214567 104/264 (39%)
DUF3543 860..1067 CDD:288883
AdukNP_731331.1 S_TKc 9..265 CDD:214567 106/266 (40%)
PKc_like 13..264 CDD:304357 103/261 (39%)
MIT_2 274..348 CDD:239147
MIT 407..472 CDD:282117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1084750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5656
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.