Sequence 1: | NP_954649.3 | Gene: | KIRREL2 / 84063 | HGNCID: | 18816 | Length: | 708 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
Alignment Length: | 274 | Identity: | 65/274 - (23%) |
---|---|---|---|
Similarity: | 102/274 - (37%) | Gaps: | 56/274 - (20%) |
- Green bases have known domain annotations that are detailed below.
Human 24 PHFLQQPEDLVVLLGEEARLPCA---LGAYWGLVQW--TKSGLALGGQRD----LPGWS-----R 74
Human 75 YWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLVPPEAPQVLGGP-SVSLVA 138
Human 139 GVPANLTCRSRGDARPTPELLWFRDGVLLDGATFHQTLLKEGTPGSVE----------STLTLTP 193
Human 194 FSHDDGATFVCRARSQALPTGRDTAITLSLQYPPEVTLSASPHTVQEGEKVIFLCQATAQPPVTG 258
Human 259 YRWAKGGSPVLGAR 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
KIRREL2 | NP_954649.3 | IG_like | 30..119 | CDD:214653 | 24/102 (24%) |
IGc2 | 38..106 | CDD:197706 | 21/81 (26%) | ||
I-set | 126..224 | CDD:254352 | 24/108 (22%) | ||
Ig2_KIRREL3-like | 141..223 | CDD:143236 | 21/91 (23%) | ||
Cell attachment site. /evidence=ECO:0000255 | 149..151 | 0/1 (0%) | |||
Ig | 231..306 | CDD:299845 | 9/42 (21%) | ||
IG_like | 234..308 | CDD:214653 | 9/39 (23%) | ||
Ig | 312..395 | CDD:299845 | |||
I-set | 317..395 | CDD:254352 | |||
Ig | 397..501 | CDD:299845 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 545..601 | ||||
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 25/103 (24%) |
Ig | 145..238 | CDD:416386 | 25/110 (23%) | ||
Ig strand A | 145..149 | CDD:409353 | 1/3 (33%) | ||
Ig strand A' | 154..159 | CDD:409353 | 3/4 (75%) | ||
Ig strand B | 165..172 | CDD:409353 | 4/8 (50%) | ||
Ig strand C | 178..183 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 203..209 | CDD:409353 | 2/5 (40%) | ||
Ig strand F | 216..223 | CDD:409353 | 2/7 (29%) | ||
Ig strand G | 230..238 | CDD:409353 | 2/7 (29%) | ||
Ig | 242..333 | CDD:416386 | 10/46 (22%) | ||
Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
Ig strand B | 259..266 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 272..277 | CDD:409353 | 2/5 (40%) | ||
Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 289..293 | CDD:409353 | |||
Ig strand E | 295..305 | CDD:409353 | |||
Ig strand F | 314..322 | CDD:409353 | |||
Ig strand G | 325..334 | CDD:409353 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |