DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment KIRREL2 and dpr3

DIOPT Version :9

Sequence 1:	NP_954649.3	Gene:	KIRREL2 / 84063	HGNCID:	18816	Length:	708	Species:	Homo sapiens
Sequence 2:	NP_001014459.2	Gene:	dpr3 / 3346208	FlyBaseID:	FBgn0053516	Length:	522	Species:	Drosophila melanogaster

Alignment Length:	171	Identity:	37/171 - (21%)
Similarity:	63/171 - (36%)	Gaps:	48/171 - (28%)

- Green bases have known domain annotations that are detailed below.

Human    74 RYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVL-VPPEAPQVLGG-PSVSL 136
            |:.::.:..:.:..||::....:|...||||.......|...||::: :.|:|..|:.| |.:..
  Fly   292 RFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHF 356

Human   137 VAGVPANLTC----RSRGDARPTPELLWFRDGVLLDGATFHQTLLKEGTPGSVESTLTLTPFSHD 197
            .||....|.|    .|..|..|   :.|:|...:                        :|||..|
  Fly   357 KAGSAIILNCLVQQPSVKDIGP---IYWYRGEHM------------------------ITPFDAD 394

Human   198 DGATFVCRARSQALPTGRDTAITLSLQYPPEVTLSASPHTV 238
            ||        ...:|.||.       ::|..:....||:.:
  Fly   395 DG--------QPEIPAGRG-------EHPQGIPEDTSPNDI 420

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
KIRREL2	NP_954649.3	IG_like	30..119	CDD:214653	11/44 (25%)
		IGc2	38..106	CDD:197706	8/31 (26%)
		I-set	126..224	CDD:254352	21/102 (21%)
		Ig2_KIRREL3-like	141..223	CDD:143236	16/85 (19%)
		Cell attachment site. /evidence=ECO:0000255	149..151		0/1 (0%)
		Ig	231..306	CDD:299845	2/8 (25%)
		IG_like	234..308	CDD:214653	2/5 (40%)
		Ig	312..395	CDD:299845
		I-set	317..395	CDD:254352
		Ig	397..501	CDD:299845
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	545..601
dpr3	NP_001014459.2	Ig	243..330	CDD:299845	8/37 (22%)
		IG_like	243..329	CDD:214653	8/36 (22%)
		Ig	350..464	CDD:299845	23/113 (20%)
		IG_like	<441..477	CDD:214653
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810