DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DTNBP1 and Dysb

DIOPT Version :9

Sequence 1:NP_115498.2 Gene:DTNBP1 / 84062 HGNCID:17328 Length:351 Species:Homo sapiens
Sequence 2:NP_001262023.1 Gene:Dysb / 40052 FlyBaseID:FBgn0036819 Length:288 Species:Drosophila melanogaster


Alignment Length:295 Identity:75/295 - (25%)
Similarity:136/295 - (46%) Gaps:46/295 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     1 MLETLRERLLS-----------VQQDF-------------TSGLKT------LSDKSREAKVKSK 35
            |...|:::|.|           :||.:             .||:.|      |::....::..|.
  Fly     1 MFGNLKKKLSSAIQEGLVISENLQQQYRQRVSSGNSGSSQASGITTPISPLGLNESLSSSRSSSL 65

Human    36 PRTVPF-----LPKY---SAGLELLSRYEDTWAALHRRAKDCASAGELVDSEVVMLSAHWEKKKT 92
            ..:.||     :|.:   :||..||::|||.|..:|...:..|.....:.:::..:......:..
  Fly    66 SLSAPFQLTDGVPSHLNVAAGCSLLAKYEDDWQQIHGANEKNAEKAAQIANQISGIQDQASHQHR 130

Human    93 SLVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLEN 157
            .:.||...|..:|.|||.|::.:..|..||...:::|..|..||||..:|||:.....|..||..
  Fly   131 IMSELNSSLAGIPTLIAQLQNSSQVLNSLEEMGKQLEIELEKLEDLREECELQEFILEQQFQLSR 195

Human   158 YKKNKRKELETFKAELDAEHAQKVLEMEHTQQMKLKERQKFFEEAFQQDMEQYLSTGYLQIAERR 222
            :|:.|..|||.::.::..:|..|:.:.|.|.....:|||..|::||::|||:|...|  |:.:.:
  Fly   196 HKQKKLNELEQYRQQIAQKHQSKIKDQEQTLLKLQRERQAVFDDAFREDMEEYKQRG--QLTKIQ 258

Human   223 EPIGSMSSMEVNVDMLEQMDLMDISDQEALDVFLN 257
            .....::..||      .::..::..::||:.|||
  Fly   259 TTSNKLALEEV------VLEANEVETKDALEQFLN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DTNBP1NP_115498.2 SMC_N <2..>202 CDD:330553 59/237 (25%)
Dysbindin 173..331 23/85 (27%)
Dysbindin 175..319 CDD:309545 23/83 (28%)
Nuclear export signal 243..256 2/12 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..351
DysbNP_001262023.1 TMPIT 94..>189 CDD:285135 25/94 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148291
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BWXP
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4980
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370127at33208
OrthoFinder 1 1.000 - - FOG0007164
OrthoInspector 1 1.000 - - oto88850
orthoMCL 1 0.900 - - OOG6_107641
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4546
SonicParanoid 1 1.000 - - X7556
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.690

Return to query results.
Submit another query.