DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT1G35710 and Lgr4

DIOPT Version :9

Sequence 1:NP_174809.1 Gene:AT1G35710 / 840475 AraportID:AT1G35710 Length:1120 Species:Arabidopsis thaliana
Sequence 2:NP_001285192.1 Gene:Lgr4 / 5740505 FlyBaseID:FBgn0085440 Length:809 Species:Drosophila melanogaster


Alignment Length:571 Identity:125/571 - (21%)
Similarity:202/571 - (35%) Gaps:160/571 - (28%)


- Green bases have known domain annotations that are detailed below.


plant    72 SCNSRG--------------------SIEELNLTNTGIEGTFQDFPFISLSNLAYVDLSMNLLSG 116
            ||..||                    .:..|:||....|...:.| |..|.::..:.|....:..
  Fly   161 SCPCRGDEILCRFQQLTDIPERLPQHDLATLDLTGNNFETIHETF-FSELPDVDSLVLKFCSIRE 224

plant   117 TIPPQFGNLS----KLIYF-DLSTNHLTGEISPSLGNLKNLTVLYLHQNYLTSVIPSELGNMESM 176
            .....|..|:    :.:|. |....||.....|. ||  .|::|.|.:|:|..:..|:..|::.:
  Fly   225 IASHAFDRLADNPLRTLYMDDNKLPHLPEHFFPE-GN--QLSILILARNHLHHLKRSDFLNLQKL 286

plant   177 TDLALSQNKLTGSIPSSLGNLKNLMVLYLYENYLTGV----IPPELGNMESMTDLALSQNKLTGS 237
            .:|.|..|::..........|.||.||||.||:|..:    .|..|.|:.:   |:|:.|::...
  Fly   287 QELDLRGNRIGNFEAEVFARLPNLEVLYLNENHLKRLDPDRFPRTLLNLHT---LSLAYNQIEDI 348

plant   238 IPSTLGNLKNLMVLYLYENYLTGVIPPEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLF 302
            ..:|. ....|..|:|..|.|:.:......|:.::..|.|::|::.|....:...||||:.|   
  Fly   349 AANTF-PFPRLRYLFLAGNRLSHIRDETFCNLSNLQGLHLNENRIEGFDLEAFACLKNLSSL--- 409

plant   303 QNYLTGGIPPKLGNIESMIDLELSNNKLTGSIPSSLGNLKNLTIL-YLYENYL--------TGVI 358
              .|||.   :...::|.:                   |||||.| |:|.::.        ..|.
  Fly   410 --LLTGN---RFQTLDSRV-------------------LKNLTSLDYIYFSWFHLCSAAMNVRVC 450

plant   359 PPELGNMESMIDLQLNNNKLTGSI-----PSSFGNLKNL--TYLY---------LYLNYLTGVIP 407
            .|....:.|.:.| |:|..|.||:     .:..|||..|  .|.|         |||.:|..   
  Fly   451 DPHGDGISSKLHL-LDNQILRGSVWVMASIAVVGNLLVLLGRYFYKSRSNVEHSLYLRHLAA--- 511

plant   408 QELGNMESMINLDLSQNKLTGSVPDSF-GNFTKLESLYLRVNHLSGAIPPGVANSSHLTTLILDT 471
                 .:.::.:.|:   |......|| |.:.|.|..:   .| ||...                
  Fly   512 -----SDFLMGIYLT---LIACADISFRGEYIKYEETW---RH-SGVCA---------------- 548

plant   472 NNFTGFFPETVCKGRKLQNISLDYNHLEG---PI-PKSLRDCKSLIR-------------ARFLG 519
              |.||.....|:...|....:.::.|..   |: |:.....:.::|             |..|.
  Fly   549 --FAGFLSTFSCQSSTLLLTLVTWDRLMSVTRPLKPRDTEKVRIVLRLLLLWGISFGLAAAPLLP 611

plant   520 NKFTGDIFEAFGIYPDLNFIDFSHN------KFHGEISSNWEKSPKLGALI 564
            |.:.|..|             :.:|      ..|...:..||.|..|..|:
  Fly   612 NPYFGSHF-------------YGNNGVCLSLHIHDPYAKGWEYSALLFILV 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT1G35710NP_174809.1 leucine-rich repeat 296..319 CDD:275380 5/22 (23%)
leucine-rich repeat 320..341 CDD:275380 0/20 (0%)
leucine-rich repeat 344..367 CDD:275380 7/31 (23%)
leucine-rich repeat 368..415 CDD:275380 16/62 (26%)
leucine-rich repeat 416..439 CDD:275380 5/23 (22%)
leucine-rich repeat 440..460 CDD:275380 4/19 (21%)
leucine-rich repeat 464..483 CDD:275380 3/18 (17%)
leucine-rich repeat 488..535 CDD:275380 10/63 (16%)
leucine-rich repeat 540..559 CDD:275380 5/24 (21%)
leucine-rich repeat 560..583 CDD:275380 2/5 (40%)
leucine-rich repeat 584..607 CDD:275380
leucine-rich repeat 608..631 CDD:275380
leucine-rich repeat 632..655 CDD:275380
leucine-rich repeat 679..702 CDD:275380
leucine-rich repeat 703..726 CDD:275380
PLN00113 33..1118 CDD:215061 125/571 (22%)
leucine-rich repeat 79..103 CDD:275380 7/23 (30%)
leucine-rich repeat 104..127 CDD:275380 3/26 (12%)
leucine-rich repeat 128..151 CDD:275380 7/23 (30%)
leucine-rich repeat 152..175 CDD:275380 7/22 (32%)
leucine-rich repeat 176..199 CDD:275380 4/22 (18%)
leucine-rich repeat 200..223 CDD:275380 11/26 (42%)
leucine-rich repeat 224..247 CDD:275380 4/22 (18%)
leucine-rich repeat 248..271 CDD:275380 6/22 (27%)
leucine-rich repeat 272..295 CDD:275380 5/22 (23%)
Lgr4NP_001285192.1 Ldl_recept_a 87..124 CDD:278486
LRR_RI <184..397 CDD:238064 54/220 (25%)
LRR_8 188..248 CDD:290566 12/60 (20%)
leucine-rich repeat 188..211 CDD:275380 7/23 (30%)
leucine-rich repeat 212..235 CDD:275380 3/22 (14%)
leucine-rich repeat 238..261 CDD:275380 7/25 (28%)
LRR_8 261..320 CDD:290566 19/58 (33%)
leucine-rich repeat 262..285 CDD:275380 7/22 (32%)
LRR_4 284..325 CDD:289563 13/40 (33%)
leucine-rich repeat 286..309 CDD:275380 4/22 (18%)
LRR_4 308..348 CDD:289563 15/42 (36%)
leucine-rich repeat 310..334 CDD:275380 10/23 (43%)
leucine-rich repeat 335..357 CDD:275380 4/25 (16%)
LRR_8 356..416 CDD:290566 18/67 (27%)
leucine-rich repeat 358..381 CDD:275380 6/22 (27%)
LRR_4 381..421 CDD:289563 12/47 (26%)
leucine-rich repeat 382..405 CDD:275380 5/22 (23%)
leucine-rich repeat 406..427 CDD:275380 8/47 (17%)
7tm_1 483..741 CDD:278431 41/213 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.