DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT1G35630 and DMA1

DIOPT Version :9

Sequence 1:NP_174800.2 Gene:AT1G35630 / 840463 AraportID:AT1G35630 Length:318 Species:Arabidopsis thaliana
Sequence 2:NP_011983.1 Gene:DMA1 / 856515 SGDID:S000001157 Length:416 Species:Saccharomyces cerevisiae


Alignment Length:275 Identity:53/275 - (19%)
Similarity:92/275 - (33%) Gaps:92/275 - (33%)


- Green bases have known domain annotations that are detailed below.


plant    33 FDDVEAT--------FTPIVRNSGECGILYVAEPLEACSDITNMAEKRSKYRSSYVLIVLGGCSF 89
            |.|..:|        |.||:|.:|....:.:....|      .:.|..||....|..:|     |
Yeast   161 FIDTSSTSVANQGLFFDPIIRTAGAGSQIIIGRYTE------RVREAISKIPDQYHPVV-----F 214

plant    90 EEKVRKAQKAGYKAAIVYNDGYDELLVPMAGNSSGVDIHGLLVTRAS----------GEVL---- 140
            :.||.......:|.     |......:....:|||..::...::.||          |:::    
Yeast   215 KSKVISRTHGCFKV-----DDQGNWFLKDVKSSSGTFLNHQRLSSASTTSKDYLLHDGDIIQLGM 274

plant   141 --KGYADQ----DEMKLWLIPGFGISSWSIMGITFISLLAMSAILATCFVVRRHQIRQSVRDLPH 199
              :|..::    .:||:.|     ..||.:....| :..|:|.|                     
Yeast   275 DFRGGTEEIYRCVKMKIEL-----NKSWKLKANAF-NKEALSRI--------------------- 312

plant   200 GGQGLSCMPRDLLQSMPTEVYSGVLEESSTSVTCAICIDDYCVGEKLRILPCKHKYHAVCIDSW- 263
                      ..||.:.|    |:.:|.     |:||::.....:.:.|.||.|.:|..|:... 
Yeast   313 ----------KNLQKLTT----GLEQED-----CSICLNKIKPCQAIFISPCAHSWHFHCVRRLV 358

plant   264 -LGRCRSFCPVCKQN 277
             :...:..||.|:.|
Yeast   359 IMNYPQFMCPNCRTN 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT1G35630NP_174800.2 PA_C_RZF_like 11..155 CDD:239038 29/149 (19%)
zf-RING_2 232..275 CDD:290367 11/44 (25%)
DMA1NP_011983.1 FHA 121..308 CDD:224630 32/168 (19%)
RING-H2_Dmap_like 325..371 CDD:319372 12/50 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.