DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT1G35630 and HRD1

DIOPT Version :9

Sequence 1:NP_174800.2 Gene:AT1G35630 / 840463 AraportID:AT1G35630 Length:318 Species:Arabidopsis thaliana
Sequence 2:NP_014630.1 Gene:HRD1 / 854149 SGDID:S000005373 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:212 Identity:42/212 - (19%)
Similarity:67/212 - (31%) Gaps:107/212 - (50%)


- Green bases have known domain annotations that are detailed below.


plant   207 MPRDLLQSMPTEV----YSGV-----------LEESSTSVT-------------CAICIDDYC-- 241
            ||..||:.:..::    .||.           |:::..:||             |.||:|:..  
Yeast   295 MPMMLLKDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHS 359

plant   242 --------VGEKLRILPCKHKYHAVCIDSWLGRCRSFCPVCK-----------QNPRTGN----- 282
                    ..:|.:.|||.|..|..|:.:|:.|.:: ||:|:           |...|.|     
Yeast   360 PNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQT-CPICRLPVFDEKGNVVQTTFTSNSDITT 423

plant   283 ---------------------DVPPASETTPLI-------------------SPSP--------- 298
                                 |:.|...|:|.|                   :|||         
Yeast   424 QTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPSPTWYTFPLHK 488

plant   299 ---NSITSLQSFYDLPI 312
               ||:.|.:|.|:..|
Yeast   489 TGDNSVGSSRSAYEFLI 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT1G35630NP_174800.2 PA_C_RZF_like 11..155 CDD:239038
zf-RING_2 232..275 CDD:290367 16/65 (25%)
HRD1NP_014630.1 HRD1 5..551 CDD:227568 42/212 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.