DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT1G35625 and HRD1

DIOPT Version :9

Sequence 1:NP_001319153.1 Gene:AT1G35625 / 840462 AraportID:AT1G35625 Length:318 Species:Arabidopsis thaliana
Sequence 2:NP_014630.1 Gene:HRD1 / 854149 SGDID:S000005373 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:218 Identity:42/218 - (19%)
Similarity:66/218 - (30%) Gaps:117/218 - (53%)


- Green bases have known domain annotations that are detailed below.


plant   206 RMPKDLLQSMPTEV----YTGV-----------LEEGSTSVT-------------CAICIDDYRV 242
            |||..||:.:..::    .:|.           |::...:||             |.||:|    
Yeast   294 RMPMMLLKDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMD---- 354

plant   243 GEIL---------------RILPCKHKYHAVCIDSWLGRCRSFCPVCK-----------QNPRTG 281
             |::               :.|||.|..|..|:.:|:.|.:: ||:|:           |...|.
Yeast   355 -ELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQT-CPICRLPVFDEKGNVVQTTFTS 417

plant   282 N--------------------------DVPPASETTPLI---------------------SP--- 296
            |                          |:.|...|:|.|                     ||   
Yeast   418 NSDITTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPSPTWY 482

plant   297 -------GPNSITSLQSFYDLPI 312
                   |.||:.|.:|.|:..|
Yeast   483 TFPLHKTGDNSVGSSRSAYEFLI 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT1G35625NP_001319153.1 None
HRD1NP_014630.1 HRD1 5..551 CDD:227568 42/218 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.