DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT1G35625 and YBR062C

DIOPT Version :9

Sequence 1:NP_001319153.1 Gene:AT1G35625 / 840462 AraportID:AT1G35625 Length:318 Species:Arabidopsis thaliana
Sequence 2:NP_009618.2 Gene:YBR062C / 852354 SGDID:S000000266 Length:180 Species:Saccharomyces cerevisiae


Alignment Length:129 Identity:29/129 - (22%)
Similarity:49/129 - (37%) Gaps:38/129 - (29%)


- Green bases have known domain annotations that are detailed below.


plant   186 RRHRIRQHVRDLHHG-------GQGHS-----------RMPKDL----LQSMPTEVYTGVLEEGS 228
            :|.::|..::.|...       |..||           .:|:.|    ||.|......|..:..:
Yeast    28 QRRQVRSQLQGLFQNFGNTSGEGDAHSDSTLLLRLLSQMLPESLQEEWLQEMDKGKSAGCPDTFA 92

plant   229 TSV------------TCAICIDDYRVGE---ILRILPCKHKYHAVCIDSWLGRCRSFCPVCKQN 277
            .|:            .|:||..:|...|   ::.:..|.||:...|:..||.|..: ||:|:.|
Yeast    93 ASLPRINKKKLKATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTT-CPLCRDN 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT1G35625NP_001319153.1 None
YBR062CNP_009618.2 RING_Ubox 109..153 CDD:418438 14/44 (32%)
RING-H2 finger (C3H2C3-type) 109..152 CDD:319361 14/43 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.