DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT1G35625 and YBR062C

DIOPT Version :10

Sequence 1:NP_001319153.1 Gene:AT1G35625 / 840462 AraportID:AT1G35625 Length:318 Species:Arabidopsis thaliana
Sequence 2:NP_009618.2 Gene:YBR062C / 852354 SGDID:S000000266 Length:180 Species:Saccharomyces cerevisiae


Alignment Length:129 Identity:29/129 - (22%)
Similarity:49/129 - (37%) Gaps:38/129 - (29%)


- Green bases have known domain annotations that are detailed below.


plant   186 RRHRIRQHVRDLHHG-------GQGHS-----------RMPKDL----LQSMPTEVYTGVLEEGS 228
            :|.::|..::.|...       |..||           .:|:.|    ||.|......|..:..:
Yeast    28 QRRQVRSQLQGLFQNFGNTSGEGDAHSDSTLLLRLLSQMLPESLQEEWLQEMDKGKSAGCPDTFA 92

plant   229 TSV------------TCAICIDDYRVGE---ILRILPCKHKYHAVCIDSWLGRCRSFCPVCKQN 277
            .|:            .|:||..:|...|   ::.:..|.||:...|:..||.|..: ||:|:.|
Yeast    93 ASLPRINKKKLKATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTT-CPLCRDN 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT1G35625NP_001319153.1 PA_C_RZF_like 11..155 CDD:239038
HRD1 <164..>291 CDD:227568 29/129 (22%)
RING-H2_RNF11 232..275 CDD:438131 14/45 (31%)
YBR062CNP_009618.2 RING_Ubox 109..153 CDD:473075 14/44 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.