DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT1G35625 and IRC20

DIOPT Version :9

Sequence 1:NP_001319153.1 Gene:AT1G35625 / 840462 AraportID:AT1G35625 Length:318 Species:Arabidopsis thaliana
Sequence 2:NP_013348.1 Gene:IRC20 / 850949 SGDID:S000004237 Length:1556 Species:Saccharomyces cerevisiae


Alignment Length:200 Identity:46/200 - (23%)
Similarity:80/200 - (40%) Gaps:55/200 - (27%)


- Green bases have known domain annotations that are detailed below.


plant    93 IRNAQEAGYKAAIVYNDRYEELLVRMAGNSSGVYIHGVLVTRTSGEVLKE-YTSRAEMELLLIPG 156
            :|....:....:.:.|  :|:.|::....|..::.:...| |.|.::|.. |.::.|.       
Yeast  1116 VRRISSSNESESTIQN--FEDYLLQYEVESKSLFKYNKQV-RESLKILGSIYNAKTEY------- 1170

plant   157 FGISSWSIMAITFVSLLVISAVLASYFSVRRHRIRQHVRDLHHGG----------------QGHS 205
              .|....::.:.|||..:||...|      |.||...:.|  ||                :..|
Yeast  1171 --YSQLQRISDSLVSLHSLSAPQLS------HLIRTINKSL--GGTLDAKINNIESRLIYLKNLS 1225

plant   206 RMPKDLLQSMPTEVYTGVLEEGSTSVTCAICIDDYRVGEILRILPCKHKYHAVCIDSWLGRCRSF 270
            |: ||.|..             :..::|:||:.:..:|.|::   |.|.:...||.:|| |..|.
Yeast  1226 RL-KDTLND-------------NQILSCSICLGEVEIGAIIK---CGHYFCKSCILTWL-RAHSK 1272

plant   271 CPVCK 275
            ||:||
Yeast  1273 CPICK 1277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT1G35625NP_001319153.1 None
IRC20NP_013348.1 HepA 172..>568 CDD:223627
DEXQc_SHPRH 383..602 CDD:350828
RAD18 1234..>1327 CDD:227719 16/47 (34%)
RING-HC_RNF10 1239..1276 CDD:319450 15/40 (38%)
SF2_C_SNF 1356..1485 CDD:350180
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I3077
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.