DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT1G35625 and Rnf167

DIOPT Version :9

Sequence 1:NP_001319153.1 Gene:AT1G35625 / 840462 AraportID:AT1G35625 Length:318 Species:Arabidopsis thaliana
Sequence 2:NP_001008362.1 Gene:Rnf167 / 360554 RGDID:1305972 Length:349 Species:Rattus norvegicus


Alignment Length:323 Identity:104/323 - (32%)
Similarity:147/323 - (45%) Gaps:61/323 - (18%)


- Green bases have known domain annotations that are detailed below.


plant    28 NTFLSFDDVEANFTPVVRRSGEYGLLYAAEPLDACSYLT---NMAEKGSKFRPSYVLIVRGGCSF 89
            |..:.|.|:.|.|...:...|..|.|..|.|.:|||.:.   :....||.|   ..|:.|..|:|
  Rat    33 NASMDFADLPALFGATLSDEGLQGFLVEAHPENACSPIAPPPSAPVNGSVF---IALLRRFDCNF 94

plant    90 EEKIRNAQEAGYKAAIVYNDRYEELLVRMAGNS----SGVYIHGVLVTRTSGEVLKE-YTSRAEM 149
            :.|:.|||:|||.||:|:|....||| .|..||    ..::|..|.:...|.|.|:. :......
  Rat    95 DLKVLNAQKAGYGAAVVHNVNSNELL-NMVWNSEEIQQQIWIPSVFIGERSAEYLRALFVYEKGA 158

plant   150 ELLLIP--GFGISSWSIMAITFVSLLVISAVLASYFSVR--RHRIRQHVRDLHHGGQGHSRMPKD 210
            .:||:|  .|.:..:.|.....|.|||::  :.:...||  :||.|..          .:|:.|:
  Rat   159 RVLLVPDNSFPLGYYLIPFTGIVGLLVLA--MGTVLIVRCIQHRKRLQ----------RNRLTKE 211

plant   211 LLQSMPTEVYTGVLEEGSTSVTCAICIDDYRVGEILRILPCKHKYHAVCIDSWLGRCRSFCPVCK 275
            .|:.:||..|    ::|.....||||:|:|..|:.||||||.|.||:.|:|.||.:.|..||:||
  Rat   212 QLKQIPTHDY----QKGDEYDVCAICLDEYEDGDKLRILPCAHAYHSRCVDPWLTQTRKTCPICK 272

plant   276 Q-------------------------NPRTGNDVPPASETTPLISPGPNSITSLQSFYDLPIV 313
            |                         .||.    .||||.|||:...|...||..|....|:|
  Rat   273 QPVHRGPGDEEQEEETQGQEEEGDEGEPRD----QPASEWTPLLGSSPTLPTSFGSLAPAPLV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT1G35625NP_001319153.1 None
Rnf167NP_001008362.1 PA_C_RZF_like 20..170 CDD:239038 46/140 (33%)
RING-H2_RNF167 228..273 CDD:319711 24/44 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..349 18/65 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3934
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I2173
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 1 1.000 - - mtm2609
orthoMCL 1 0.900 - - OOG6_103040
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.