DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT1G35625 and C18B12.4

DIOPT Version :9

Sequence 1:NP_001319153.1 Gene:AT1G35625 / 840462 AraportID:AT1G35625 Length:318 Species:Arabidopsis thaliana
Sequence 2:NP_510498.1 Gene:C18B12.4 / 181600 WormBaseID:WBGene00007666 Length:456 Species:Caenorhabditis elegans


Alignment Length:280 Identity:71/280 - (25%)
Similarity:120/280 - (42%) Gaps:45/280 - (16%)


- Green bases have known domain annotations that are detailed below.


plant    57 EPLDACSYLTNMAEKGSKFRPSYVLIVRGG----CSFEEKIRNAQEAGY--KAAIVYNDRYEELL 115
            ||:|||..:.......::....:..:.|..    |.|..:....|.:.|  :..|.||...:| .
 Worm    74 EPVDACGPVRIAQNHTTRCHNLFAFVSRSNISHPCKFSHQAFMVQNSTYPFRLVIFYNYPGQE-P 137

plant   116 VRMAGNS--SGVYIHGVLVTRT-SGEVLKEYTSRA--EMELLLIPGFGISSWSIMAITFVSLLVI 175
            :.|.|..  ..|.|..::::.. ..|:.|:::..|  .:.:.:.||:    :.:.......|:||
 Worm   138 ISMEGTELRDKVNIPVLMISHACKEEIAKKFSDTAGYRLRVRIDPGY----YELFRYLIPFLVVI 198

plant   176 SAVLASYF-------SVRRHRIRQHVRDLHHGGQGHSRMPKDLLQSMPTEVYTGVLEEGSTSVTC 233
            ....|.:.       .|.|.::.:.            |:.|..|:.:|.:.|    ..|....||
 Worm   199 VFCFALFLITLCVRGCVERRKLNKR------------RLSKRNLKKIPVKKY----RLGDDPDTC 247

plant   234 AICIDDYRVGEILRILPCKHKYHAVCIDSWLGRCRSFCPVCKQNPRTGNDVPPASETTPLISPGP 298
            |||::.:..||.||.|||:|.:|..|||.||.:.|..||:||:...|.:|...::......|.||
 Worm   248 AICLESFASGEKLRHLPCRHVFHCNCIDVWLTQTRKICPLCKRKIGTDSDSECSTNDLASTSQGP 312

plant   299 NSITSL------QSFYDLPI 312
            |..|:|      ||.::||:
 Worm   313 NDATALYNNADNQSGFELPV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT1G35625NP_001319153.1 None
C18B12.4NP_510498.1 PA <74..176 CDD:333703 21/102 (21%)
HRD1 <223..>335 CDD:227568 42/126 (33%)
RING-H2_RNF103 246..291 CDD:319387 24/44 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2961
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I2122
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 1 1.000 - - otm278
orthoMCL 1 0.900 - - OOG6_103040
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X670
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.