DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARCL1 and Fs

DIOPT Version :9

Sequence 1:NP_001121782.1 Gene:SPARCL1 / 8404 HGNCID:11220 Length:664 Species:Homo sapiens
Sequence 2:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster


Alignment Length:494 Identity:110/494 - (22%)
Similarity:170/494 - (34%) Gaps:156/494 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    84 SAEQGKSSSQELGLKDQEDSDGHLSVNLEYAPTEGTLDIKEDMSEPQEKK--LSENTDFLAPGVS 146
            :|.:.::..|||.|:.:.:.:                :.:::|..|:|.:  .||||:|     :
  Fly   303 AALRRRTHQQELELEQEPELE----------------EEQQEMKPPRESRSLSSENTNF-----N 346

Human   147 SFTDSNQQESITKREENQE--QPRNYSHHQL---NRSSKHSQGLRDQGNQEQDPNISNGEEEEEK 206
            ...|..|::    |.:||.  |||...|.:|   :.||:.|..|.||....:...:.....|..:
  Fly   347 LGLDGGQRQ----RADNQRKLQPRESKHRRLLIIDSSSRSSSNLPDQPTSGRRGRVEMTGYERRR 407

Human   207 EPGEVGTH---------NDN------------------QERKTELPREHANSKQEEDNTQSDD-- 242
            .....|.|         ||:                  |.|...|  .:||....:.|.||..  
  Fly   408 HRNNHGKHLTRSMTTGANDSFPADKTPAQSPAADSILAQSRLANL--ANANEPANDINRQSSTRV 470

Human   243 ------ILEESDQPTQ-VSKMQEDEFDQGNQEQEDNSNAEMEEENASNVNKHIQETEWQSQEGKT 300
                  .:|.:..|.. :.|.|..:..|...:.:|..|.|.:..|.         |...|..|.|
  Fly   471 RHQHARRIEHAPNPDNGLRKRQHKQQQQHQHQHQDRMNTEAQSANT---------TVSGSGSGAT 526

Human   301 GLEAISNHKETEEKTVSEALLMEPTDDGNTTPRNHGVDDDGDDDGDDGGTDGPRHSASDDYFIPS 365
            ....||..:...|...|       :|..||....|           .||...|         :|.
  Fly   527 NHRRISQLQHGSETAAS-------SDLANTHDLAH-----------LGGIYAP---------LPP 564

Human   366 QAFLEAERAQSIAYHLKIEEQREKVHENENIGT---TEPGEHQEAKKAENSSNEE-ETSSEGNMR 426
            |                        |.|...||   |...|.|..|:|..::|.: |.:..|   
  Fly   565 Q------------------------HSNPVCGTDGRTYNTECQLRKRACRTNNAQLEVAYRG--- 602

Human   427 VHAVDSCMSFQCKRGHICKADQQGKPHCV-CQDPVTCP------PTKPLDQ---VCGTDNQTYAS 481
             |..:||....|..|..|..||...|||: |:  :.||      .:...|:   |||.|.:||.|
  Fly   603 -HCKNSCSGVHCLNGLTCVEDQYLMPHCIACR--IECPWDNLDVDSSGYDERQAVCGVDGKTYRS 664

Human   482 SCHLFATKCRLEGTKKGHQLQLDYFGACKS-IPTCTDFE 519
            :|.:....|::     |..:.:.|.|.|:: ..:|.|.:
  Fly   665 ACDINRMICKI-----GRSIAVAYPGPCRAGRVSCADIK 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCL1NP_001121782.1 O-glycosylated at one additional site 25..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..360 66/318 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 388..426 12/41 (29%)
KAZAL_FS 433..512 CDD:294071 26/89 (29%)
SPARC_Ca_bdg 513..648 CDD:287550 2/7 (29%)
SPARC_EC 514..662 CDD:238155 2/6 (33%)
FsNP_652376.2 KAZAL 564..604 CDD:197624 13/67 (19%)
KAZAL_FS 654..687 CDD:238052 12/37 (32%)
KAZAL_FS 723..767 CDD:238052
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4004
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.