DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX14 and Sox15

DIOPT Version :9

Sequence 1:NP_004180.1 Gene:SOX14 / 8403 HGNCID:11193 Length:240 Species:Homo sapiens
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:239 Identity:71/239 - (29%)
Similarity:109/239 - (45%) Gaps:68/239 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     2 SKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRA 66
            |.....|:|||||||||::.:|:|:|.|||.:||:::||.||.:|:.|:..::|||::||:|||.
  Fly   209 SAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRV 273

Human    67 QHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPP 131
            .||.|||:|||||||:.::.|:                    .:..|..:...|:|         
  Fly   274 IHMTEHPNYKYRPRRRKQSKLR--------------------AMQPGGKEQSESSP--------- 309

Human   132 ASAPYSLLDPAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNP 196
                    :|....|.:..|:...|  |||.:..|.                        :||:.
  Fly   310 --------NPGTGGSKSNPKLATPP--LATASSSYT------------------------TPTDE 340

Human   197 GYVVPCNCTAWSASTLQPPVAY--ILFPGMTKTGIDPYSSAHAT 238
            .   .||.|..:.....|...|  .|.|..:.:.:|.||:|.:|
  Fly   341 S---TCNSTNQNHGQSTPGGLYEQPLKPTYSPSSVDCYSNADST 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX14NP_004180.1 SOX-TCF_HMG-box 7..78 CDD:238684 39/70 (56%)
SOXp 77..>118 CDD:403523 7/40 (18%)
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 39/70 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.