DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A11 and Bmcp

DIOPT Version :9

Sequence 1:XP_024306762.1 Gene:SLC25A11 / 8402 HGNCID:10981 Length:342 Species:Homo sapiens
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:333 Identity:102/333 - (30%)
Similarity:150/333 - (45%) Gaps:64/333 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    25 FLFGGLAGMGATVFVQPLDLVKNRMQLSG----EGAKTREYKTSFHALTSILKAEGLRGIYTGYW 85
            |::||:|.:.|.....|:|..|.|:|:.|    :......|:....|...|.:.||||.:|:|.|
  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIW 74

Human    86 GLRMEGRLWVGSSRPWPDMLTPLLLRLSAGLLRQATYTTTRLGIYTVL----FER--LTGADGTP 144
                                        ..:||||||.|.:.|.|..|    .||  |...||:.
  Fly    75 ----------------------------PAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSE 111

Human   145 ---PGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVL 206
               ...|..|    .|||..:.:..|.:|..:||...|:   .|.:|....|.   .|.:.|||.
  Fly   112 RVWSNILCAA----AAGAISSAIANPTDVLKVRMQVHGK---GQHKGLLGCFG---EIYKYEGVR 166

Human   207 TLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIA 271
            .||||..||..||||:.:.:|..|...|..|:::  |.|::..||.:|.|:.|.:..||.|:|:.
  Fly   167 GLWRGVGPTAQRAVVIASVELPVYDFCKLQLMNA--FGDHVGNHFISSFIASLGSAIASTPIDVI 229

Human   272 KTRIQNMRMID----------GKPE-YKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTF 325
            :||:.|.|.:.          ..|: |...||...:.:|.||..:|:|||.|.:.|:||..::.|
  Fly   230 RTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFF 294

Human   326 IFLEQMNK 333
            |..||:.|
  Fly   295 ITYEQLKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A11XP_024306762.1 Mito_carr 24..>85 CDD:278578 20/63 (32%)
Mito_carr 144..241 CDD:278578 31/99 (31%)
Mito_carr 243..337 CDD:278578 35/102 (34%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 31/114 (27%)
Mito_carr <132..199 CDD:278578 26/72 (36%)
Mito_carr 204..303 CDD:278578 33/99 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.