DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A11 and CG18327

DIOPT Version :9

Sequence 1:XP_024306762.1 Gene:SLC25A11 / 8402 HGNCID:10981 Length:342 Species:Homo sapiens
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:326 Identity:91/326 - (27%)
Similarity:156/326 - (47%) Gaps:57/326 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    25 FLFGGLAGMGATVFVQPLDLVKNRMQLSGE----GAKTREYKTSFHALTSILKAEGLRGIYTGYW 85
            |:.||:|.|||.||..|::::|.|:||.||    |:..:.||:.|.|..::.|.:|:.|:..|  
  Fly     6 FVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKG-- 68

Human    86 GLRMEGRLWVGSSRPWPDMLTPLLLRLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFL-- 148
                                      |:..|..|....:.||.|||...|:         |::  
  Fly    69 --------------------------LAPALCFQFVINSFRLSIYTHAVEK---------GWVHN 98

Human   149 ----LKAVIGMTAGATGAFVGT--PAEVALIRMTADGRLPADQRRGYK----NVFNALIRITREE 203
                :....||..||.|..||:  .:...||:.....:.......||:    ::.:|:.:|.|:.
  Fly    99 NKGEISFAKGMFWGALGGVVGSYCASPFFLIKTQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKN 163

Human   204 GVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPV 268
            ||..||||.:..::||.|.:|.|:|.:.|:|..|.::|..:...:..||:.:.:|...:.|..|:
  Fly   164 GVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLKENGVVTHPTILSFCSGLAAGSFVSLAITPL 228

Human   269 DIAKTRIQNMRMIDGKPE---YKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQ 330
            |:..||:.| :.:|.:..   |:..||.:..::|.||.:.|:|||.|.|.|..|::.|..:|.::
  Fly   229 DVVTTRLYN-QGVDAQGRGIYYRGWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDE 292

Human   331 M 331
            :
  Fly   293 L 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A11XP_024306762.1 Mito_carr 24..>85 CDD:278578 25/63 (40%)
Mito_carr 144..241 CDD:278578 30/108 (28%)
Mito_carr 243..337 CDD:278578 26/92 (28%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 30/108 (28%)
PTZ00169 5..293 CDD:240302 91/324 (28%)
Mito_carr 101..201 CDD:278578 29/99 (29%)
Mito_carr 204..296 CDD:278578 26/91 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.