DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A11 and CG8323

DIOPT Version :9

Sequence 1:XP_024306762.1 Gene:SLC25A11 / 8402 HGNCID:10981 Length:342 Species:Homo sapiens
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:323 Identity:88/323 - (27%)
Similarity:146/323 - (45%) Gaps:51/323 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    25 FLFGGLAGMGATVFVQPLDLVKNRMQLSGE----GAKTREYKTSFHALTSILKAEGLRGIYTGYW 85
            |:.||||.:|||.|..|::::|.|:||.||    |.....||...:|..::.|.:|:.|:..|  
  Fly     6 FVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKG-- 68

Human    86 GLRMEGRLWVGSSRPWPDMLTPLLLRLSAGLLRQATYTTTRLGIYTVLFER-----LTGADGTPP 145
                                      |:..|..|....:.||.||:...||     ..|......
  Fly    69 --------------------------LAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGM 107

Human   146 GFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYK----NVFNALIRITREEGVL 206
            |.|..|:    .|..|.:..:|  ..||:.....:.......||:    ::.:||.:|....||.
  Fly   108 GLLWGAI----GGVVGCYFSSP--FFLIKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVR 166

Human   207 TLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIA 271
            .||||.:..:.||.:.:.||:|::.::|..|:.....:...|..|.|.:|:|.:.:.|..|.|:.
  Fly   167 GLWRGSVAALPRAALGSGAQIATFGKTKALLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVI 231

Human   272 KTRIQNMRMIDGKPE---YKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQM 331
            .||:.| :.:|.:..   |:..||...|::|.||.:.::|||...|.|:.||:.|..:|.:::
  Fly   232 TTRLYN-QGVDAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A11XP_024306762.1 Mito_carr 24..>85 CDD:278578 24/63 (38%)
Mito_carr 144..241 CDD:278578 26/100 (26%)
Mito_carr 243..337 CDD:278578 28/92 (30%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 29/108 (27%)
PTZ00169 5..293 CDD:240302 88/321 (27%)
Mito_carr 101..200 CDD:278578 27/104 (26%)
Mito_carr 206..301 CDD:278578 28/89 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.