DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A11 and Ucp4B

DIOPT Version :9

Sequence 1:XP_024306762.1 Gene:SLC25A11 / 8402 HGNCID:10981 Length:342 Species:Homo sapiens
Sequence 2:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster


Alignment Length:332 Identity:98/332 - (29%)
Similarity:155/332 - (46%) Gaps:48/332 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    17 RTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTS----ILKAEGL 77
            :.:|....:|....:...|.:...|.|:.|.|||:.||.|.....|..:..|.:    |::.|||
  Fly    32 KKTPPVELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGL 96

Human    78 RGIYTGYWGLRMEGRLWVGSSRPWPDMLTPLLLRLSAGLLRQATYTTTRLGIYTVLFERL--TGA 140
            ..:|.|                            :||.|.|.:.::..::..|..:.|::  ...
  Fly    97 LKLYGG----------------------------ISAMLFRHSLFSGIKMLTYDYMREKMIVPDE 133

Human   141 DGTPP-GFLLKAVIGMTAGATGAFVGTPAEVALIRMTADG--RLPADQRRGYKNVFNALIRITRE 202
            ||.|. .||...:.|:.||||.:.:..|.|:..|:|..:|  ||..:..| ..||..||..|.|.
  Fly   134 DGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGEPPR-IHNVLQALTSIYRT 197

Human   203 EGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMP 267
            .||:.||:|.:|...|:.:|....::.|...|:||:......||....|.|:|.:|:.....|:|
  Fly   198 GGVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLP 262

Human   268 VDIAKTRIQNM------RMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFI 326
            .|:.|:||.|.      |.|    .||..||.|.::||.|||.:::|||.||:.|:||.:|:.::
  Fly   263 ADVVKSRIMNQPTDEQGRGI----HYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWM 323

Human   327 FLEQMNK 333
            ..||:.:
  Fly   324 TFEQIRR 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A11XP_024306762.1 Mito_carr 24..>85 CDD:278578 19/64 (30%)
Mito_carr 144..241 CDD:278578 34/99 (34%)
Mito_carr 243..337 CDD:278578 36/97 (37%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 87/306 (28%)
Mito_carr 32..129 CDD:278578 26/124 (21%)
Mito_carr 138..233 CDD:278578 32/95 (34%)
Mito_carr 246..331 CDD:278578 34/89 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.