DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A11 and Ucp4A

DIOPT Version :9

Sequence 1:XP_024306762.1 Gene:SLC25A11 / 8402 HGNCID:10981 Length:342 Species:Homo sapiens
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:358 Identity:99/358 - (27%)
Similarity:163/358 - (45%) Gaps:61/358 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAATASAGAGGIDGKPRTSPKSVKF----------LFGGLAGMGATVFVQPLDLVKNRMQLSGEG 55
            :|::.|:......|:.:..|  |||          :...:|...|.:...||||.|.|:|:.|||
  Fly    12 VASSTSSNPAPSSGRHQLRP--VKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEG 74

Human    56 AKTREYKTSFHALTSILKAEGLRGIYTGYWGL-RMEG--RLWVGSSRPWPDMLTPLLLRLSAGLL 117
            |.....|::..          .||:....:|: |.||  :||.|        :||       .|.
  Fly    75 AAHSAGKSNMQ----------YRGMVATAFGIAREEGALKLWQG--------VTP-------ALY 114

Human   118 RQATYTTTRLGIYTVLFERLT--GADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADG- 179
            |...|:..|:..|.::.:..|  |....|  ....|:.|:||||...::.:||::..:::..:| 
  Fly   115 RHVVYSGVRICSYDLMRKEFTQNGTQALP--VWKSALCGVTAGAVAQWLASPADLVKVQIQMEGR 177

Human   180 -RLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYF 243
             ||..:..|.: :..:|..:|.:..|:..||:|.||.:.||.:||...|.:|...|..:::....
  Fly   178 RRLMGEPPRVH-SAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQM 241

Human   244 SDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNG--------LDVLFKVVRY 300
            .|....|..||:.:|.|......|.|:.||||.|      :|..:||        :|.|.:.|..
  Fly   242 PDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMN------QPTDENGRGLLYRGSVDCLRQTVSK 300

Human   301 EGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNK 333
            |||.:|:|||.|.:.|:.|.::..::..||:.|
  Fly   301 EGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC25A11XP_024306762.1 Mito_carr 24..>85 CDD:278578 18/70 (26%)
Mito_carr 144..241 CDD:278578 28/98 (29%)
Mito_carr 243..337 CDD:278578 32/99 (32%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 92/329 (28%)
Mito_carr 39..138 CDD:278578 31/123 (25%)
Mito_carr 142..239 CDD:278578 28/99 (28%)
Mito_carr 248..336 CDD:278578 31/92 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.