DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACBP6 and anox

DIOPT Version :9

Sequence 1:NP_174462.1 Gene:ACBP6 / 840069 AraportID:AT1G31812 Length:92 Species:Arabidopsis thaliana
Sequence 2:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster


Alignment Length:75 Identity:27/75 - (36%)
Similarity:43/75 - (57%) Gaps:5/75 - (6%)


- Green bases have known domain annotations that are detailed below.


plant     9 EH-AEKVNTLTELPSNEDLLILYGLYKQAKFGPVDTSRPGMFSMKERAKWDAWKAVEGKSSEEAM 72
            || |::.|::    .:.||||.||.||||..||.....||:..::.::||.||:.:...|...|.
  Fly    18 EHVAKQSNSI----GSADLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTMSQSAAR 78

plant    73 NDYITKVKQL 82
            ..|:.|:::|
  Fly    79 QAYVQKLQEL 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACBP6NP_174462.1 ACBP 3..87 CDD:238248 27/75 (36%)
anoxNP_001027085.1 ACBP 10..90 CDD:279259 27/75 (36%)
ANK 125..231 CDD:238125
Ank_2 125..212 CDD:289560
ANK repeat 148..179 CDD:293786
ANK repeat 181..212 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.