DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSSK6 and par-1

DIOPT Version :9

Sequence 1:NP_114426.1 Gene:TSSK6 / 83983 HGNCID:30410 Length:273 Species:Homo sapiens
Sequence 2:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster


Alignment Length:260 Identity:100/260 - (38%)
Similarity:153/260 - (58%) Gaps:6/260 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    12 YKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVF 76
            |||.:|||:|:::|||:|........||||::|:.:..|..:.| |.||:.|::.:.||:||.:|
  Fly   253 YKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQK-LFREVRIMKMLDHPNIVKLF 316

Human    77 EFIEVCNGKLYIVME-AAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCEN 140
            :.||. ...||::|| |:..::...:..:||:...:||..|.||..||:|.|...::|||||.||
  Fly   317 QVIET-EKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAEN 380

Human   141 VLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVM 205
            :||. .|..:|:.||||..:......|. |:|||..||:||:..|..||..:.||||:||:||.:
  Fly   381 LLLD-SELNIKIADFGFSNEFTPGSKLD-TFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTL 443

Human   206 VTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAG 270
            |:|.:|||.|.:..|..|..|| .|.....:|..|:.|:.:.|..:|:.|.|...:..:.|:..|
  Fly   444 VSGSLPFDGSTLRELRERVLRG-KYRIPFYMSTDCENLLRKFLVLNPAKRASLETIMGDKWMNMG 507

Human   271  270
              Fly   508  507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSSK6NP_114426.1 STKc_TSSK6-like 11..267 CDD:271066 98/255 (38%)
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 98/255 (38%)
S_TKc 253..504 CDD:214567 98/255 (38%)
UBA_MARK_Par1 525..563 CDD:270522
MARK1-3_C 839..936 CDD:213381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.