DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GUT2 and sotv

DIOPT Version :9

Sequence 1:NP_174064.1 Gene:GUT2 / 839635 AraportID:AT1G27440 Length:412 Species:Arabidopsis thaliana
Sequence 2:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster


Alignment Length:340 Identity:79/340 - (23%)
Similarity:119/340 - (35%) Gaps:90/340 - (26%)


- Green bases have known domain annotations that are detailed below.


plant    45 KLKVYVYELPSKYNKKLLQKDPRCLTHMFAAEIF-MHRFLLSSPVRTRNPDEADWFYTPIYPTCD 108
            :||||:|.|....::   |.|....|  .::|.| :...:|.|...|.||:||..|         
  Fly   107 RLKVYIYPLQEFVDE---QSDKTATT--LSSEYFQILEAVLKSRYYTSNPNEACLF--------- 157

plant   109 LTPTGLPLPFKSPRMMRSSIQLISSN-------------WPYWNRTEGADH--FFVVPHDFGACF 158
                   ||         |:.|::.|             ..:|:|  ||:|  |.::|       
  Fly   158 -------LP---------SLDLLNQNVFDKHLAGAALASLDFWDR--GANHIIFNMLP------- 197

plant   159 HYQEEKAIERGILPLLQRATLVQTFGQRNHVCLDEG----------SITIPPFAPP-QKMQAH-- 210
                      |..|.......|.|   .|.:....|          .:.||.::|. .:..||  
  Fly   198 ----------GGAPSYNTVLDVNT---DNAIIFGGGFDSWSYRPGFDVAIPVWSPRLVRQHAHAT 249

plant   211 ----FIPPDIPRSIFVYFRGLFYDVNNDPEGGYYARGARAAVWENFKNNPLFDISTDHPTTYYED 271
                |:......:|...|.....:::..........||    .||........:|..|.:..|..
  Fly   250 AQRKFLLVVAQLNILPRFVRTLRELSLAHSEQLLLLGA----CENLDLTMRCPLSQHHKSLEYPR 310

plant   272 -MQRAIFCLCPLGWAPWSPRLVEAVVFGCIPVIIADDIVLPFADAIPWEEIGVFVAEKDVPELDT 335
             :.|..|||.........|.|||.:...|||||..|:.||||.|.|.|....|.:.|.::..:..
  Fly   311 LLSRGKFCLLGRSLRMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENELHSVMQ 375

plant   336 ILTSIPTEVILRKQR 350
            .|.:|.:..|:..|:
  Fly   376 KLKAISSVKIVEMQK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GUT2NP_174064.1 Exostosin 45..340 CDD:397245 76/328 (23%)
sotvNP_725536.1 Exostosin 105..380 CDD:281069 76/328 (23%)
Glyco_transf_64 455..689 CDD:286358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.