DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSSK1B and CG9222

DIOPT Version :10

Sequence 1:NP_114417.1 Gene:TSSK1B / 83942 HGNCID:14968 Length:367 Species:Homo sapiens
Sequence 2:NP_608999.2 Gene:CG9222 / 33867 FlyBaseID:FBgn0031784 Length:337 Species:Drosophila melanogaster


Alignment Length:273 Identity:123/273 - (45%)
Similarity:181/273 - (66%) Gaps:11/273 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     6 VLKRRGYLLGINLGEGSYAKVKSAYSERLKFNVAIKIIDRKKAPADFLEKFLPREIEILAMLNHC 70
            :|:..|.:||..:|.|:|||||..:||.....||:|||.:.|||:::.:||||||||.:..|:|.
  Fly    70 ILEEHGIILGKVIGTGNYAKVKIGFSEEYGKRVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHE 134

Human    71 SIIKTYEIFETSHGKVYIVMELAVQGDLLELIKTRGALHEDEARKKFHQLSLAIKYCHDLDVVHR 135
            ::|..|:..|||| :||::|:||..|.||:.::.|..|.|.::|..|.||..|::|.|...||||
  Fly   135 NLITFYQSIETSH-RVYLIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHR 198

Human   136 DLKCDNLLLDKDFNIKLSDFSFSKRCLRDDSGRMALSKTFCGSPAYAAPEVLQGIPYQPKVYDIW 200
            |:||:|||||:::|:||.||.|:::..|....::.||||||||.|||:||:|:|:.|.|.:.|||
  Fly   199 DIKCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEILKGVAYDPFMSDIW 263

Human   201 SLGVILYIMVCGSMPYDDSNIKKMLRIQKEHRVN----FPRSKHLTGECKDLIYHMLQPDVNRRL 261
            :.||:.|.||.|.:|||.||:..:|:     |:|    ||:|...:.|||.:|.|:|.| |..|.
  Fly   264 ACGVVCYAMVFGRLPYDGSNVHILLK-----RINQSLVFPKSPSASSECKHMIMHILAP-VKIRY 322

Human   262 HIDEILSHCWMQP 274
            :|.::....|..|
  Fly   323 NIPQVKEDPWYSP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSSK1BNP_114417.1 STKc_TSSK1_2-like 10..272 CDD:271067 120/265 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..367
CG9222NP_608999.2 STKc_TSSK4-like 75..333 CDD:271064 120/264 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.