DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSSK1B and par-1

DIOPT Version :9

Sequence 1:NP_114417.1 Gene:TSSK1B / 83942 HGNCID:14968 Length:367 Species:Homo sapiens
Sequence 2:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster


Alignment Length:282 Identity:106/282 - (37%)
Similarity:165/282 - (58%) Gaps:30/282 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    12 YLLGINLGEGSYAKVKSAYSERLKFNVAIKIIDRKKAPADFLEKFLPREIEILAMLNHCSIIKTY 76
            |.|...:|:|::||||.|........|||||||:.:.....|:| |.||:.|:.||:|.:|:|.:
  Fly   253 YKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQK-LFREVRIMKMLDHPNIVKLF 316

Human    77 EIFETSHGKVYIVMELAVQGDLLELIKTRGALHEDEARKKFHQLSLAIKYCHDLDVVHRDLKCDN 141
            ::.||.. .:|::||.|..|::.:.:...|.:.|.|||.||.|:..|::|||...::|||||.:|
  Fly   317 QVIETEK-TLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAEN 380

Human   142 LLLDKDFNIKLSDFSFSKRCLRDDSGRMALSK--TFCGSPAYAAPEVLQGIPYQPKVYDIWSLGV 204
            ||||.:.|||::||.||......       ||  ||||||.|||||:.||..|.....|:|||||
  Fly   381 LLLDSELNIKIADFGFSNEFTPG-------SKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGV 438

Human   205 ILYIMVCGSMPYDDSNIKKMLR--IQKEHRVNFPRSKHLTGECKDLIYHMLQPDVNRRLHIDEIL 267
            |||.:|.||:|:|.|.::::..  ::.::|:.|    :::.:|::|:...|..:..:|..::.|:
  Fly   439 ILYTLVSGSLPFDGSTLRELRERVLRGKYRIPF----YMSTDCENLLRKFLVLNPAKRASLETIM 499

Human   268 SHCWM-------------QPKA 276
            ...||             :|||
  Fly   500 GDKWM
NMGFEEDELKPYIEPKA 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSSK1BNP_114417.1 STKc_TSSK1_2-like 10..272 CDD:271067 101/263 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..367 1/1 (100%)
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 101/263 (38%)
S_TKc 253..504 CDD:214567 101/263 (38%)
UBA_MARK_Par1 525..563 CDD:270522
MARK1-3_C 839..936 CDD:213381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.