DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP6 and Decay

DIOPT Version :9

Sequence 1:NP_001217.2 Gene:CASP6 / 839 HGNCID:1507 Length:293 Species:Homo sapiens
Sequence 2:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster


Alignment Length:263 Identity:91/263 - (34%)
Similarity:133/263 - (50%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    43 RRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVS 107
            |.|||||.||:.....   .:|.||..|||::.......||:|:.|:||...|:...:.||:...
  Fly    54 RAGIALILNHKDVKGQ---KQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVARED 115

Human   108 HADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPV 172
            |:..||||...:|||....:||.|....::.|...|.||.|.:|..|||:|.||||||..     
  Fly   116 HSQNDCFVLAVMSHGTEGKVYAKDMSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGAN----- 175

Human   173 IPLDVVDNQTEKLDTNITEVDAASV----YTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLC 233
            :...|..:....:...:....||:|    |.:|:.||.|:.||..:.::|.|...:|||:||.||
  Fly   176 LEKAVEFSSFAVMTRELVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLC 240

Human   234 EMLGKYGSS-------LEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTK--KLHFF 289
            .:|.:..::       :|...|||.|||||:.......|:.:....|::|.|.|.|||  :|...
  Fly   241 RVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTKTFQLRVK 305

Human   290 PKS 292
            ||:
  Fly   306 PKT 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP6NP_001217.2 CASc 37..290 CDD:214521 89/259 (34%)
DecayNP_477462.1 CASc 54..302 CDD:237997 88/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152729
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.