DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP6 and Dcp-1

DIOPT Version :9

Sequence 1:NP_001217.2 Gene:CASP6 / 839 HGNCID:1507 Length:293 Species:Homo sapiens
Sequence 2:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster


Alignment Length:266 Identity:102/266 - (38%)
Similarity:142/266 - (53%) Gaps:21/266 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    34 AEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLL 98
            |.:|.|.|:.||:||||||| ||...:|..|.||..|...|.:.|.:|||.|....|.|..::|.
  Fly    68 ASEYNMSHKHRGVALIFNHE-FFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILK 131

Human    99 KIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAC 163
            .:.:.:.:.|.|.||.....|||||..::||.|.:.::..:...|....|.||.||||:|.||||
  Fly   132 HVGKAAELDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFTATFCPSLAGKPKLFFIQAC 196

Human   164 RGNQHDVPVIPLDVVDNQTEKLDTNITEVD--AASVYTLPAGADFLMCYSVAEGYYSHRETVNGS 226
            :|::.|..:           .|:..:||.|  :::.|.:|..||||..||...||:|.|...|||
  Fly   197 QGDRLDGGI-----------TLEKGVTETDGESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGS 250

Human   227 WYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKD----PSAIGKKQVPCFASMLTKKLH 287
            ||:|.|...|...|...:...|||.||::|:   :||..:    |....:||:||..||||:.|.
  Fly   251 WYMQSLIRELNANGKKYDLLTLLTFVNQRVA---LDFESNVPATPMMDRQKQIPCLTSMLTRILR 312

Human   288 FFPKSN 293
            |..|.|
  Fly   313 FGDKPN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP6NP_001217.2 CASc 37..290 CDD:214521 99/258 (38%)
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 98/256 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3066
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.