DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT1G22670 and DMA1

DIOPT Version :9

Sequence 1:NP_173681.1 Gene:AT1G22670 / 838873 AraportID:AT1G22670 Length:422 Species:Arabidopsis thaliana
Sequence 2:NP_011983.1 Gene:DMA1 / 856515 SGDID:S000001157 Length:416 Species:Saccharomyces cerevisiae


Alignment Length:78 Identity:24/78 - (30%)
Similarity:37/78 - (47%) Gaps:11/78 - (14%)


- Green bases have known domain annotations that are detailed below.


plant   222 AKIDN----TTGF---SCAICLEDYIVGDKLRVLPCSHKFHVACVDSWLI-SWRTF-CPVCKR-- 275
            ::|.|    |||.   .|:|||........:.:.||:|.:|..||...:| ::..| ||.|:.  
Yeast   310 SRIKNLQKLTTGLEQEDCSICLNKIKPCQAIFISPCAHSWHFHCVRRLVIMNYPQFMCPNCRTNC 374

plant   276 DARTTADEPLATE 288
            |..||.:....:|
Yeast   375 DLETTLESESESE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT1G22670NP_173681.1 PA_C_RZF_like 17..160 CDD:239038
HRD1 <163..>314 CDD:227568 24/78 (31%)
mRING-H2-C3H2C2D_ZSWM2 231..274 CDD:319400 14/44 (32%)
modified RING-H2 finger (C3H2C2D-type) 232..273 CDD:319400 14/42 (33%)
DMA1NP_011983.1 FHA 121..308 CDD:224630
RING-H2_Dmap_like 325..371 CDD:319372 14/45 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.