DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TM2D2 and bisc

DIOPT Version :10

Sequence 1:NP_510882.1 Gene:TM2D2 / 83877 HGNCID:24127 Length:214 Species:Homo sapiens
Sequence 2:NP_001356967.1 Gene:bisc / 37443 FlyBaseID:FBgn0034626 Length:203 Species:Drosophila melanogaster


Alignment Length:158 Identity:54/158 - (34%)
Similarity:77/158 - (48%) Gaps:24/158 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    65 DPHSPVILCSYLP--DEFIECEDP----VDHVGNATASQELGYGCLKFGGQAYSDVEHTSVQCHA 123
            :.|...:.|:.|.  .:|: |.||    :|     ..:|:|. ||.:.|        ...|.|.|
  Fly    15 ETHQINVDCNELQMMGQFM-CPDPARGQID-----PKTQQLA-GCTREG--------RARVWCIA 64

Human   124 LDGIECASP--RTFLRENKPCIKYTGHYFITTLLYSFFLGCFGVDRFCLGHTGTAVGKLLTLGGL 186
            .:.|.|...  .||.|| .||....|::..||||.|.|||.||||||.||:.|..:.|..||||:
  Fly    65 ANEINCTETGNATFTRE-VPCKWTNGYHLDTTLLLSVFLGMFGVDRFYLGYPGIGLLKFCTLGGM 128

Human   187 GIWWFVDLILLITGGLMPSDGSNWCTVY 214
            .:...:|::|:....:.|:|||.:...|
  Fly   129 FLGQLIDIVLIALQVVGPADGSAYVIPY 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TM2D2NP_510882.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..59
TM2 146..195 CDD:428337 24/48 (50%)
biscNP_001356967.1 TM2 94..137 CDD:428337 23/42 (55%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.