DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHT1;8 and CG33233

DIOPT Version :9

Sequence 1:NP_001323235.1 Gene:PHT1;8 / 838678 AraportID:AT1G20860 Length:586 Species:Arabidopsis thaliana
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:505 Identity:102/505 - (20%)
Similarity:160/505 - (31%) Gaps:178/505 - (35%)


- Green bases have known domain annotations that are detailed below.


plant    81 LFTDAYDLFCIAPVMKMIS---HVYYNGDSINTAVL--------------STSYAIALLG--TAT 126
            |.|..|.|..:  ::.|:|   ::|...:|:....|              .|..|.:|||  .|:
  Fly    10 LLTIGYGLGQV--IIFMVSFFIYMYSVTESMTAGYLVVLTSCEFDTSPKEKTLLANSLLGGMVAS 72

plant   127 GQLVFGYLGDRVGRRRVYGLCLIIMILSSFGCGFSVCTTRRSCVM---VSLGFFRFFLGLGIGGD 188
            | |..|:|.||.||:.|..|.|:..:      .|||.    |.:|   .||...|..:|..:...
  Fly    73 G-LFIGFLADRYGRKFVIRLALVGAL------SFSVI----SALMPDLYSLSVIRIIVGTFLSAV 126

plant   189 YPLSATIMSEFANKRTRGAFIAAVFSMQGLGILVSSAVTMAVCVAFKRSGGGLEVDAAAPTEADL 253
            ..|....:.||...:.|...:|.....|||.::....|.||:.      .....||.::.....:
  Fly   127 ASLQVGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAIL------PNNFNVDLSSSYNLRV 185

plant   254 AWRLILMIGALPAALTFYWRMLMPETARYTALVENNIVQAAKDMQRVMSRSHISDEATTDPPPPP 318
             ||.::|...:|..|......|:|||..:...|..                              
  Fly   186 -WRFLMMFFMIPGWLALVGICLVPETPHFLMSVNR------------------------------ 219

plant   319 PPPSYKLFSRCFFRLHGRDLFAASFNWFLVDIVFYTSNLLLSHIFSHYSKKPSTAENVYDAAFEV 383
             |....|..:...|::.:       .|..|||.       ||      .:|.||.:.        
  Fly   220 -PDKALLALKWICRMNRK-------KWEDVDIT-------LS------EEKSSTNDQ-------- 255

plant   384 AELGAIIAACSTIPGYWFTVYFIDKIGRVKIQIMGFFFMAVIYLVAGIPYS------WYWSKHEH 442
                         .|:|.||::..|:...|..:..||.  .::|:.||.::      |:......
  Fly   256 -------------EGFWKTVWYEYKLLFSKPHVFKFFI--CLFLIFGIFFTSIGLGIWFPVIRNM 305

plant   443 NNKGFMVLYGLVFFFCNFGPNTTTFIIPAEHFPARFRSTCHGISGAAGKLGAIVGTVGFLWATKK 507
            :|.|...|       |:...|..|||   .|                                  
  Fly   306 DNSGSNRL-------CDLVNNNPTFI---NH---------------------------------- 326

plant   508 MESDDKNQIYPE-----------VNRMRIAFLILGGVCIAGILVTYFFTK 546
             |:||.|....|           ::.:...|..:|...:|.:||.:...|
  Fly   327 -EADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFILASVLVHWMTRK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHT1;8NP_001323235.1 None
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 98/491 (20%)
MFS 23..>208 CDD:119392 50/202 (25%)
MFS 354..>482 CDD:304372 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.