DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP5 and Decay

DIOPT Version :9

Sequence 1:NP_001129584.1 Gene:CASP5 / 838 HGNCID:1506 Length:447 Species:Homo sapiens
Sequence 2:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster


Alignment Length:314 Identity:77/314 - (24%)
Similarity:126/314 - (40%) Gaps:67/314 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   168 ESAESTNILKLCPREEFLR---LCKKNHDEIYPIKKREDRRRLALIICNTKFDHLPARNGAHYDI 229
            :.|::|.|......|..|:   :.:..:::.|   :...|..:|||:.:........|.|...|.
  Fly    18 DKADATKIAHTPTSELDLKRIIISRPTNEDTY---ENCARAGIALILNHKDVKGQKQRVGTERDR 79

Human   230 VGMKRLLQGLGYTVVDEKNLTARDMESVLRAFAARPEHKSSDSTFLVLMSHGILEGICGTAHKKK 294
            ..|:..|||.|:.|....:||..::...|:. .||.:|..:|...|.:|||       ||..|..
  Fly    80 DDMEATLQGFGFDVRTFDDLTFSEINDTLKE-VAREDHSQNDCFVLAVMSH-------GTEGKVY 136

Human   295 KPDVLL-YDTIFQIFNNRNCLSLKDKPKVIIVQACRG---EKHGELWVRDSPASLALISSQSSEN 355
            ..|:.. .:.::..|...||.:||:|||:..:|||||   ||..|.      :|.|:::.:....
  Fly   137 AKDMSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAVEF------SSFAVMTRELVPE 195

Human   356 LEA---DSVCKIHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLME------ 411
            ..|   .....|....|.:.|.|:.....|:|:...||.||..|          |.:::      
  Fly   196 PAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSL----------CRVLDQAAANE 250

Human   412 ---------------IFRKVQKSFE-------VPQAKAQMPTIERATLTRDFYL 443
                           :.|||...::       :.|.| :||.. .:|||:.|.|
  Fly   251 AATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMK-EMPNF-MSTLTKTFQL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP5NP_001129584.1 DD 76..155 CDD:301326
CASc 196..445 CDD:214521 72/283 (25%)
DecayNP_477462.1 CASc 54..302 CDD:237997 70/273 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152725
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.