DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP5 and Dcp-1

DIOPT Version :9

Sequence 1:NP_001129584.1 Gene:CASP5 / 838 HGNCID:1506 Length:447 Species:Homo sapiens
Sequence 2:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster


Alignment Length:276 Identity:72/276 - (26%)
Similarity:119/276 - (43%) Gaps:36/276 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   180 PREEFL-RLCKKNHDEIYPIKKREDRRRLALIICNTKFD--HLPARNGAHYDIVGMKRLLQGLGY 241
            |..:|: |:..:.:...|.:..:  .|.:|||..:..||  .|.:|.|.:.|...:|:..:.||:
  Fly    54 PANKFVARMPVERYASEYNMSHK--HRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGF 116

Human   242 TVVDEKNLTARDMESVLR--AFAARPEHKSSDSTFLVLMSHGILEGICGTAHKKKKPDVLLYDTI 304
            .|...|:...||   :|:  ..||..:|..:|...:.::|||      ...:...|......|.|
  Fly   117 AVSVHKDCKLRD---ILKHVGKAAELDHTDNDCLAVAILSHG------EHGYLYAKDTQYKLDNI 172

Human   305 FQIFNNRNCLSLKDKPKVIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKD 369
            :..|....|.||..|||:..:|||:|::        ....:.|....:..:.|:.:..||....|
  Fly   173 WHYFTATFCPSLAGKPKLFFIQACQGDR--------LDGGITLEKGVTETDGESSTSYKIPIHAD 229

Human   370 FIAFCSSTPHNVSWRDRTRGSIF----ITELITCFQKYSCCCHLMEIFRKVQKSFE--VP----- 423
            |:...|:.|...|||:...||.:    |.||....:||.....|..:.::|...||  ||     
  Fly   230 FLFSYSTIPGYFSWRNINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRVALDFESNVPATPMM 294

Human   424 QAKAQMPTIERATLTR 439
            ..:.|:|.: .:.|||
  Fly   295 DRQKQIPCL-TSMLTR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP5NP_001129584.1 DD 76..155 CDD:301326
CASc 196..445 CDD:214521 69/259 (27%)
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 69/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.