DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM4B and SPBC23E6.01c

DIOPT Version :9

Sequence 1:NP_113680.1 Gene:RBM4B / 83759 HGNCID:28842 Length:359 Species:Homo sapiens
Sequence 2:NP_596601.2 Gene:SPBC23E6.01c / 2540551 PomBaseID:SPBC23E6.01c Length:473 Species:Schizosaccharomyces pombe


Alignment Length:211 Identity:45/211 - (21%)
Similarity:84/211 - (39%) Gaps:64/211 - (30%)


- Green bases have known domain annotations that are detailed below.


Human     4 LFIGNLPREATEQEIRSLF-EQY-----GKVL---ECDIIKNYGFVHIEDKTAAEDAIRNLHHYK 59
            :|:|:|.....|.::.||| .:|     .|::   :.::.:.||||...|:...:.|:..:....
pombe   188 IFVGDLSPNVNEFDVYSLFASRYNSCKSAKIMTDPQTNVSRGYGFVRFTDENDQKSALAEMQGQI 252

Human    60 LHGVNINVEASKNKSK--------------------------------ASTKLHVGNISPTCTNQ 92
            .....|.|..:..|||                                |::.:.||.:|...:.:
pombe   253 CGDRPIRVGLATPKSKAHVFSPVNVVPVSMPPVGFYSAAQPVPQFADTANSTVFVGGLSKFVSEE 317

Human    93 ELRAKFEEYGPVI--------ECDIVKDYAFVHMERAEDAVEAIRG--LDNTEFQGKRMHVQLST 147
            ||:..|:.:|.::        .|..|:   ||:.:.||.|:..::|  |.|:       .::||.
pombe   318 ELKYLFQNFGEIVYVKIPPGKGCGFVQ---FVNRQSAEIAINQLQGYPLGNS-------RIRLSW 372

Human   148 SRLR---TAPGMGDQS 160
            .|.:   .||.:..||
pombe   373 GRNQNPIAAPALNYQS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM4BNP_113680.1 RRM1_RBM4 2..68 CDD:410018 16/72 (22%)
RRM2_RBM4 78..144 CDD:410019 17/75 (23%)
PTZ00368 <145..>181 CDD:173561 7/19 (37%)
ZnF_C2HC 161..176 CDD:197667 45/211 (21%)
Interaction with TNPO3. /evidence=ECO:0000250 196..359
SPBC23E6.01cNP_596601.2 RRM 70..376 CDD:223796 41/197 (21%)
RRM1_NGR1_NAM8_like 94..173 CDD:241055
RRM2_NGR1_NAM8_like 185..264 CDD:241057 17/75 (23%)
RRM3_NGR1_NAM8_like 302..373 CDD:240792 19/80 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 48 1.000 Domainoid score I3906
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.