DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATMPK13 and rl

DIOPT Version :9

Sequence 1:NP_001030990.1 Gene:ATMPK13 / 837303 AraportID:AT1G07880 Length:363 Species:Arabidopsis thaliana
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:345 Identity:174/345 - (50%)
Similarity:235/345 - (68%) Gaps:7/345 - (2%)


- Green bases have known domain annotations that are detailed below.


plant    21 VLGNIFELSSKYIPPIEPIGRGAYGIVCCATNSETNEEVAIKKIANAFDNRVDAKRTLREIKLLS 85
            :.|.|||:..:|| .:..||.||||:|..|.::.||:.|||||| :.|:::...:||||||.:|:
  Fly    27 IRGQIFEVGPRYI-KLAYIGEGAYGMVVSADDTLTNQRVAIKKI-SPFEHQTYCQRTLREITILT 89

plant    86 HMDHDNVIKIKDIIELPEKERFEDVYIVYELMDTDLHQIIRSTQTLTDDHCQYFLYQILRGLKYI 150
            ...|:|:|.|:||:.:...::..|||||..||:|||::::: ||.|::||..|||||||||||||
  Fly    90 RFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLK-TQRLSNDHICYFLYQILRGLKYI 153

plant   151 HSANVLHRDLKPSNLVLNTNCDLKICDFGLARTS----NETEIMTEYVVTRWYRAPELLLNSSEY 211
            |||||||||||||||:||..||||||||||||.:    :.|..:||||.||||||||::|||..|
  Fly   154 HSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGY 218

plant   212 TGAIDIWSVGCIFMEILRRETLFPGKDYVQQLKLITELLGSPDDSDLDFLRSDNARKYVKQLPHV 276
            |.:|||||||||..|:|....:||||.|:.||..|..:||||...||:.:.::.||.|::.||..
  Fly   219 TKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFK 283

plant   277 QKQSFREKFPNISPMALDLAEKMLVFDPSKRITVDEALKQPYLASLHEINEEPTCPTPFSFDFEE 341
            ....:.:.|||...:||||..|||.|:|.|||.|:|||..|||...::..:||....||..:.|.
  Fly   284 PNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMEN 348

plant   342 TALDEQDIKELVWRESLHFK 361
            ..:....:|.|::.|:|.||
  Fly   349 DDISRDALKSLIFEETLKFK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATMPK13NP_001030990.1 STKc_TEY_MAPK 26..362 CDD:143363 172/340 (51%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 169/336 (50%)
S_TKc 38..326 CDD:214567 157/290 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 349 1.000 Inparanoid score I618
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 1 1.000 - - otm2432
orthoMCL 1 0.900 - - OOG6_100339
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X259
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.