DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YPEL3 and Ype

DIOPT Version :10

Sequence 1:NP_113665.3 Gene:YPEL3 / 83719 HGNCID:18327 Length:157 Species:Homo sapiens
Sequence 2:NP_572882.1 Gene:Ype / 32295 FlyBaseID:FBgn0288857 Length:121 Species:Drosophila melanogaster


Alignment Length:88 Identity:47/88 - (53%)
Similarity:58/88 - (65%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    59 YSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTT 123
            ::||.|..:|.|...|||..|.|:.||||||..|||:.....:|||:|||.|.|.|:.|:||...
  Fly    15 FNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGRHMVRDVMCKNCGAK 79

Human   124 LGWKYEQAFESSQKYKEGKYIIE 146
            |||.||.|.|.|||||||:.|:|
  Fly    80 LGWMYEFATEESQKYKEGRVILE 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YPEL3NP_113665.3 RLR_C_like 59..148 CDD:472430 47/88 (53%)
YpeNP_572882.1 RLR_C_like 14..107 CDD:472430 47/88 (53%)

Return to query results.
Submit another query.