DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JAM3 and hbs

DIOPT Version :9

Sequence 1:NP_116190.3 Gene:JAM3 / 83700 HGNCID:15532 Length:310 Species:Homo sapiens
Sequence 2:NP_001286439.1 Gene:hbs / 44129 FlyBaseID:FBgn0029082 Length:1235 Species:Drosophila melanogaster


Alignment Length:241 Identity:61/241 - (25%)
Similarity:106/241 - (43%) Gaps:55/241 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    47 ESVELSCI------------ITDSQTSDP--RIEWKKIQDEQTTYVFFDN-KIQG-DLAGRAEIL 95
            |:|::|.:            |.||.:|:|  :|.|.|           |. .::| :||.|..:.
  Fly   544 ETVKISVVPKNLVPGIRAKLICDSSSSNPPAKISWWK-----------DGIPVEGLNLANRPGLW 597

Human    96 G--KTSLKIW-NVTR-RDSALYRC----EVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPV 152
            |  .::|::: |:|: .|..:|.|    ||:.|:..:.|.   :::....|..||    .....|
  Fly   598 GGSVSTLEMYVNITQDLDGIVYTCQSHNEVLQRSVHETIS---LDILYPPKFETP----QSTTFV 655

Human   153 G-KMATLHCQ-ESEGHPRP-HYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDS 214
            | :.|..|.: .:.|:|.. .|:|.::.:|:.::|.:..|..:....||       .:.:.::|:
  Fly   656 GVEGAPFHVELLASGNPMVITYTWTKDGLPISSNSLSGQRLISDGPRLN-------ISRLSRNDA 713

Human   215 GQYYCIASNDAGSARCEEQEMEVYDLNIGGIIGGVLVVL---AVLA 257
            |.|.|.|.|..|:|..|.|....|...|..:..|...|.   ||||
  Fly   714 GVYICEALNSQGTALLEIQVAVEYAPTITAVSEGRSFVAGEPAVLA 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JAM3NP_116190.3 IG 42..135 CDD:214652 27/111 (24%)
Ig 156..231 CDD:319273 19/76 (25%)
hbsNP_001286439.1 Ig 44..122 CDD:299845
IG_like 45..137 CDD:214653
Ig 153..231 CDD:299845
IG_like 258..342 CDD:214653
Ig 266..327 CDD:299845
IG_like 357..>414 CDD:214653
Ig 360..427 CDD:299845
Ig <468..526 CDD:299845
I-set 547..633 CDD:254352 24/96 (25%)
Ig 556..631 CDD:299845 22/85 (26%)
I-set 644..735 CDD:254352 26/101 (26%)
IGc2 668..725 CDD:197706 15/63 (24%)
IG_like 751..829 CDD:214653 5/9 (56%)
IGc2 753..815 CDD:197706 4/7 (57%)
Ig 852..928 CDD:143165
FN3 935..1017 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.