DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JAM3 and Lac

DIOPT Version :9

Sequence 1:NP_116190.3 Gene:JAM3 / 83700 HGNCID:15532 Length:310 Species:Homo sapiens
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:238 Identity:57/238 - (23%)
Similarity:86/238 - (36%) Gaps:64/238 - (26%)


- Green bases have known domain annotations that are detailed below.


Human     1 MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRI 65
            :::||||                        |...:|.::.|..|...|::.|..:...|  |.|
  Fly   129 LSVRRPP------------------------VISDNSTQSVVASEGSEVQMECYASGYPT--PTI 167

Human    66 EWKK-----IQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEV---VARND 122
            .|::     :..:..|||                 |.| |:|.:|.:.|...|.|..   |::.|
  Fly   168 TWRRENNAILPTDSATYV-----------------GNT-LRIKSVKKEDRGTYYCVADNGVSKGD 214

Human   123 RKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRAN 187
            |:.|:     :.|:..||..|.|......:.....|.| ..|.:|.|...|.::|:.|..    |
  Fly   215 RRNIN-----VEVEFAPVITVPRPRLGQALQYDMDLEC-HIEAYPPPAIVWTKDDIQLAN----N 269

Human   188 PRFRNSSFHLNSE--TGTLVFTAVHKDDSGQYYCIASNDAGSA 228
            ..:..|.|....|  ..||....|.|...|.|.|.|:|..|.|
  Fly   270 QHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEA 312

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
JAM3NP_116190.3 IG 42..135 CDD:214652 23/100 (23%)
Ig 156..231 CDD:319273 23/75 (31%)
LacNP_523713.2 IG_like 36..131 CDD:214653 0/1 (0%)
FR1 37..50 CDD:409353
Ig strand A' 37..42 CDD:409353
Ig strand B 44..51 CDD:409353
CDR1 51..59 CDD:409353
Ig strand C 59..63 CDD:409353
FR2 60..63 CDD:409353
CDR2 67..81 CDD:409353
Ig strand C' 68..72 CDD:409353
Ig strand C' 79..81 CDD:409353
FR3 84..115 CDD:409353
Ig strand D 84..90 CDD:409353
Ig strand E 94..102 CDD:409353
Ig strand F 108..115 CDD:409353
CDR3 116..124 CDD:409353