DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JAM3 and boi

DIOPT Version :9

Sequence 1:NP_116190.3 Gene:JAM3 / 83700 HGNCID:15532 Length:310 Species:Homo sapiens
Sequence 2:NP_001096868.3 Gene:boi / 31229 FlyBaseID:FBgn0040388 Length:1105 Species:Drosophila melanogaster


Alignment Length:212 Identity:55/212 - (25%)
Similarity:81/212 - (38%) Gaps:57/212 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    30 GAVNLKSSNRTPVVQEFESVELSCII--TDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRA 92
            |::..:||.|..|..:      :|::  ..|..|:|...|.          |:.|   |....::
  Fly   143 GSMGARSSIRWSVAPK------NCLLIRCGSVISNPPAIWS----------FYRN---GKKLPQS 188

Human    93 EIL--GKTSLKIWNVTRRDSALYRCEVVARN----DRKEIDEIVIELTVQVKPVTP---VCRVP- 147
            |:|  ...:|.:..||.:|:..|.|  ||.|    |...:.: .|||.|.....||   :.|.| 
  Fly   189 ELLPGAAGALVLDTVTAKDAGNYSC--VATNSITGDELRLPQ-TIELRVDYTDRTPPYFLQRPPI 250

Human   148 --KAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPR----FRNSSFHLNSETGTLVF 206
              .|.| |:...|.| ...|.|||...|            ::|.    :.|.|..|:.   .|..
  Fly   251 EYSARP-GETVVLEC-PGVGSPRPRVIW------------SSPNVVEIYNNRSTILSY---GLQI 298

Human   207 TAVHKDDSGQYYCIASN 223
            |.|..:|.|.|.|:..|
  Fly   299 TDVKPEDQGSYICMLDN 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JAM3NP_116190.3 IG 42..135 CDD:214652 24/100 (24%)
Ig 156..231 CDD:319273 19/72 (26%)
boiNP_001096868.3 IG_like 42..131 CDD:214653
IG_like 154..234 CDD:214653 24/101 (24%)
Ig 172..234 CDD:299845 20/77 (26%)
IG_like 249..329 CDD:214653 23/84 (27%)
Ig 257..329 CDD:299845 20/75 (27%)
IG_like 339..418 CDD:214653
Ig 352..408 CDD:299845
FN3 470..592 CDD:238020
FN3 613..700 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.