DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RMR1 and YBR062C

DIOPT Version :10

Sequence 1:NP_201417.1 Gene:RMR1 / 836748 AraportID:AT5G66160 Length:310 Species:Arabidopsis thaliana
Sequence 2:NP_009618.2 Gene:YBR062C / 852354 SGDID:S000000266 Length:180 Species:Saccharomyces cerevisiae


Alignment Length:68 Identity:21/68 - (30%)
Similarity:37/68 - (54%) Gaps:4/68 - (5%)


- Green bases have known domain annotations that are detailed below.


plant   227 KAGETCAICLEDYRFGE---SLRLLPCQHAFHLNCIDSWLTKWGTSCPVCKHDIRTETMSSEVHK 288
            ||.:.|:||..:|...|   .:.|..|.|.|.|.|:..||:: .|:||:|:.::....:.:|:..
Yeast   104 KATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSR-STTCPLCRDNVMGHRIINEIDT 167

plant   289 RES 291
            .|:
Yeast   168 TEA 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RMR1NP_201417.1 PA_C_RZF_like 28..166 CDD:239038
RING_Ubox 230..277 CDD:473075 17/49 (35%)
YBR062CNP_009618.2 RING_Ubox 109..153 CDD:473075 16/44 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.