powered by:
Protein Alignment RMR1 and YBR062C
DIOPT Version :9
Sequence 1: | NP_201417.1 |
Gene: | RMR1 / 836748 |
AraportID: | AT5G66160 |
Length: | 310 |
Species: | Arabidopsis thaliana |
Sequence 2: | NP_009618.2 |
Gene: | YBR062C / 852354 |
SGDID: | S000000266 |
Length: | 180 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 68 |
Identity: | 21/68 - (30%) |
Similarity: | 37/68 - (54%) |
Gaps: | 4/68 - (5%) |
- Green bases have known domain annotations that are detailed below.
plant 227 KAGETCAICLEDYRFGE---SLRLLPCQHAFHLNCIDSWLTKWGTSCPVCKHDIRTETMSSEVHK 288
||.:.|:||..:|...| .:.|..|.|.|.|.|:..||:: .|:||:|:.::....:.:|:..
Yeast 104 KATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSR-STTCPLCRDNVMGHRIINEIDT 167
plant 289 RES 291
.|:
Yeast 168 TEA 170
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
54 |
1.000 |
Domainoid score |
I2894 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.