DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RMR1 and rnf13

DIOPT Version :9

Sequence 1:NP_201417.1 Gene:RMR1 / 836748 AraportID:AT5G66160 Length:310 Species:Arabidopsis thaliana
Sequence 2:NP_001008015.1 Gene:rnf13 / 493377 XenbaseID:XB-GENE-954771 Length:383 Species:Xenopus tropicalis


Alignment Length:344 Identity:105/344 - (30%)
Similarity:158/344 - (45%) Gaps:58/344 - (16%)


- Green bases have known domain annotations that are detailed below.


plant     8 CLLVAAPFLSSL-------------LRVSLATVVLNSISASFADLPAKFDGSVTKNGICGALYVA 59
            |:.:..||.:.|             ::..:|....:::|.:|.||||:|...:..:|:.|.:..|
 Frog     7 CVALMKPFCNLLAFCSCLAVIHLVPVQADVAAYTADNVSRTFDDLPARFGYRLPSDGLKGYIVTA 71

plant    60 DPLDGCS-----PLLHAAASNWTQHRTTKFALIIRGECSFEDKLLNAQNSGFQAVIVYDNIDNED 119
            .|.:.|.     |||....|      :....||.|.||:|:.|:||||.:||:|.:|| |:|::|
 Frog    72 KPENACQPISPPPLLRDNTS------SVFIVLIKRLECNFDLKVLNAQKAGFKAAVVY-NVDSDD 129

plant   120 LIVMKVNPQD----ITVDAVFVSNVAGEILRKYARGRDGECCLNPPDRGSAWTVLAISF-----F 175
            ||.|..|..|    |.:.:||:...:...|::......|...:..||.........|.|     .
 Frog   130 LISMGSNDVDILKQIDIPSVFIGESSARFLKEEFSWEKGGYIVLVPDLTLPLEYYLIPFLIIVGI 194

plant   176 SLLLIVTFLLIAFFAPRHWTQWRGRHTRTIRLDAKLVHTLPCFTFTDSAHHKAGETCAICLEDYR 240
            .|:|||.|::..|...||    |.|..| :|.|.  :..||...|.....:   :.||:||::|.
 Frog   195 CLVLIVIFMITKFVQDRH----RARRNR-LRKDQ--LKKLPIHKFKKGDEY---DVCAVCLDEYE 249

plant   241 FGESLRLLPCQHAFHLNCIDSWLTKWGTSCPVCKH-------DIRTETMSSEVHKRES------- 291
            .|:.||:|||.||:|..|:|.||||...:|||||.       |..:::.||:.....|       
 Frog   250 EGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSESDSDSSQEDNEVSENTPLLR 314

plant   292 PRTDTSTSRFAFAQSSQSR 310
            |....||..|.....|.|:
 Frog   315 PMASASTQSFGAISESHSQ 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RMR1NP_201417.1 PA_C_RZF_like 28..166 CDD:239038 47/146 (32%)
RING 231..277 CDD:238093 25/52 (48%)
rnf13NP_001008015.1 PA_C_RZF_like 24..181 CDD:239038 48/163 (29%)
RING_Ubox 239..284 CDD:388418 24/44 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I5240
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H13493
Inparanoid 1 1.050 146 1.000 Inparanoid score I2056
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 1 1.000 - - mtm3637
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.