DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RMR1 and Rnf167

DIOPT Version :9

Sequence 1:NP_201417.1 Gene:RMR1 / 836748 AraportID:AT5G66160 Length:310 Species:Arabidopsis thaliana
Sequence 2:NP_001008362.1 Gene:Rnf167 / 360554 RGDID:1305972 Length:349 Species:Rattus norvegicus


Alignment Length:317 Identity:99/317 - (31%)
Similarity:154/317 - (48%) Gaps:36/317 - (11%)


- Green bases have known domain annotations that are detailed below.


plant     3 LVVSSCLLVAAPFLSSLLRVSLATVVLNSISASFADLPAKFDGSVTKNGICGALYVADPLDGCSP 67
            :||::.|..||| :..|:|   ||...|: |..||||||.|..:::..|:.|.|..|.|.:.|||
  Rat    10 VVVATVLWGAAP-IRGLIR---ATSEHNA-SMDFADLPALFGATLSDEGLQGFLVEAHPENACSP 69

plant    68 LLHAAASNWTQHRTTKFALIIRGECSFEDKLLNAQNSGFQAVIVYDNIDNEDLIVMKVN----PQ 128
            :  |...:...:.:...||:.|.:|:|:.|:||||.:|:.|.:|: |:::.:|:.|..|    .|
  Rat    70 I--APPPSAPVNGSVFIALLRRFDCNFDLKVLNAQKAGYGAAVVH-NVNSNELLNMVWNSEEIQQ 131

plant   129 DITVDAVFVSNVAGEILRKYARGRDGECCLNPPDRGSAWTVLAISFFSL--LLIV---TFLLIAF 188
            .|.:.:||:...:.|.||.......|...|..||.........|.|..:  ||::   |.|::  
  Rat   132 QIWIPSVFIGERSAEYLRALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGTVLIV-- 194

plant   189 FAPRHWTQWRGRHTRTIRLDAKLVHTLPCFTFTDSAHHKAGETCAICLEDYRFGESLRLLPCQHA 253
                ...|.|.|..|. ||..:.:..:|...:.....:   :.|||||::|..|:.||:|||.||
  Rat   195 ----RCIQHRKRLQRN-RLTKEQLKQIPTHDYQKGDEY---DVCAICLDEYEDGDKLRILPCAHA 251

plant   254 FHLNCIDSWLTKWGTSCPVCKHDI---------RTETMSSEVHKRESPRTDTSTSRF 301
            :|..|:|.|||:...:||:||..:         ..||...|....|....|...|.:
  Rat   252 YHSRCVDPWLTQTRKTCPICKQPVHRGPGDEEQEEETQGQEEEGDEGEPRDQPASEW 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RMR1NP_201417.1 PA_C_RZF_like 28..166 CDD:239038 46/141 (33%)
RING 231..277 CDD:238093 24/45 (53%)
Rnf167NP_001008362.1 PA_C_RZF_like 20..170 CDD:239038 52/157 (33%)
RING-H2_RNF167 228..273 CDD:319711 23/44 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..349 8/38 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3934
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I2173
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 1 1.000 - - mtm2609
orthoMCL 1 0.900 - - OOG6_103040
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.