DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RMR1 and C18B12.4

DIOPT Version :9

Sequence 1:NP_201417.1 Gene:RMR1 / 836748 AraportID:AT5G66160 Length:310 Species:Arabidopsis thaliana
Sequence 2:NP_510498.1 Gene:C18B12.4 / 181600 WormBaseID:WBGene00007666 Length:456 Species:Caenorhabditis elegans


Alignment Length:283 Identity:76/283 - (26%)
Similarity:120/283 - (42%) Gaps:68/283 - (24%)


- Green bases have known domain annotations that are detailed below.


plant    53 CGALYVADPLDGCSPLLHAAASNWTQHRTTK----FALIIRGE----CSFEDKLLNAQNS--GFQ 107
            ||.  ..:|:|.|.|:..|      |:.||:    ||.:.|..    |.|..:....|||  .|:
 Worm    69 CGV--GVEPVDACGPVRIA------QNHTTRCHNLFAFVSRSNISHPCKFSHQAFMVQNSTYPFR 125

plant   108 AVIVYDNIDNEDLIVMKVNPQD-ITVDAVFVSNVA-GEILRKYA--RGRDGECCLNPPDRGSAWT 168
            .||.|:....|.:.:.....:| :.:..:.:|:.. .||.:|::  .|......::|        
 Worm   126 LVIFYNYPGQEPISMEGTELRDKVNIPVLMISHACKEEIAKKFSDTAGYRLRVRIDP-------- 182

plant   169 VLAISFFSLL-LIVTFLLIAFF---------APRHWTQWRGRHTRTIRLDAKLVHTLPCFTFTDS 223
                .::.|. .::.||::..|         ..|...:.|..:.|  ||..:.:..:|.      
 Worm   183 ----GYYELFRYLIPFLVVIVFCFALFLITLCVRGCVERRKLNKR--RLSKRNLKKIPV------ 235

plant   224 AHHKAG---ETCAICLEDYRFGESLRLLPCQHAFHLNCIDSWLTKWGTSCPVCKHDIRTETMSSE 285
            ..::.|   :|||||||.:..||.||.|||:|.||.||||.|||:....||:||..|.|:     
 Worm   236 KKYRLGDDPDTCAICLESFASGEKLRHLPCRHVFHCNCIDVWLTQTRKICPLCKRKIGTD----- 295

plant   286 VHKRESPRTDTSTSRFAFAQSSQ 308
                    :|:..|....|.:||
 Worm   296 --------SDSECSTNDLASTSQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RMR1NP_201417.1 PA_C_RZF_like 28..166 CDD:239038 30/126 (24%)
RING 231..277 CDD:238093 28/45 (62%)
C18B12.4NP_510498.1 PA <74..176 CDD:333703 27/107 (25%)
HRD1 <223..>335 CDD:227568 40/109 (37%)
RING-H2_RNF103 246..291 CDD:319387 28/44 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2961
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I2122
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 1 1.000 - - otm278
orthoMCL 1 0.900 - - OOG6_103040
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X670
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.720

Return to query results.
Submit another query.