DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gabbr2 and CG33310

DIOPT Version :10

Sequence 1:NP_113990.2 Gene:Gabbr2 / 83633 RGDID:619864 Length:940 Species:Rattus norvegicus
Sequence 2:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster


Alignment Length:138 Identity:30/138 - (21%)
Similarity:51/138 - (36%) Gaps:29/138 - (21%)


- Green bases have known domain annotations that are detailed below.


  Rat   749 NPDAATQNRRFQFTQ-NQKKEDSKTSTSVTSVNQA-----STSRLEGLQSENHRLRMKITE---- 803
            ||.....|.|...|. ::|.::||..:|..|:.||     ...:|....:....:..|:.|    
  Fly    23 NPSKDDVNTRGSLTSLSEKNDESKNPSSSASLQQAPKVAPKPKKLSISDAGKDTVTQKVKENEEP 87

  Rat   804 -LDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILSLGNFTESTDGGKAILKNHLDQNPQLQWNT 867
             ..|..|:.::.::.....:...|:|.           .....|..||:::|...|:|       
  Fly    88 GFSKQFEKESIGVRANRNSSATKKENE-----------KLLVKTVPGKSLIKESNDEN------- 134

  Rat   868 TEPSRTCK 875
            .||||..|
  Fly   135 VEPSRRTK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gabbr2NP_113990.2 PBP1_GABAb_receptor 57..459 CDD:380589
7tmC_GABA-B-R2 479..748 CDD:320421
TM helix 1 479..504 CDD:320421
TM helix 2 516..537 CDD:320421
TM helix 3 553..577 CDD:320421
TM helix 4 596..616 CDD:320421
TM helix 5 652..678 CDD:320421
TM helix 6 687..710 CDD:320421
TM helix 7 717..742 CDD:320421
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..789 9/32 (28%)
GBR2_CC 778..816 CDD:465774 8/47 (17%)
CG33310NP_995718.2 Na_K-ATPase <703..846 CDD:471796
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.