DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HTB4 and His2B:CG33868

DIOPT Version :10

Sequence 1:NP_200799.1 Gene:HTB4 / 836113 AraportID:AT5G59910 Length:150 Species:Arabidopsis thaliana
Sequence 2:NP_001027385.1 Gene:His2B:CG33868 / 3772265 FlyBaseID:FBgn0053868 Length:123 Species:Drosophila melanogaster


Alignment Length:132 Identity:91/132 - (68%)
Similarity:104/132 - (78%) Gaps:11/132 - (8%)


- Green bases have known domain annotations that are detailed below.


plant    19 PVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKKSVETYKIYIFKVLKQVHPDIGISSK 83
            |.:...||    |:|..||.|.:.|.     |||||.|:|  |:|.|||:|||||||||.|||||
  Fly     2 PPKTSGKA----AKKAGKAQKNITKT-----DKKKKRKRK--ESYAIYIYKVLKQVHPDTGISSK 55

plant    84 AMGIMNSFINDIFEKLAQEASKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT 148
            ||.|||||:|||||::|.|||:||.|||:.|||||||||||||:|||||||||||||||||||:|
  Fly    56 AMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT 120

plant   149 SS 150
            ||
  Fly   121 SS 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HTB4NP_200799.1 HFD_H2B 61..148 CDD:467035 72/86 (84%)
His2B:CG33868NP_001027385.1 HFD_H2B 33..120 CDD:467035 72/86 (84%)

Return to query results.
Submit another query.