DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gtf2a1 and stnB

DIOPT Version :9

Sequence 1:NP_113568.2 Gene:Gtf2a1 / 83602 MGIID:1933277 Length:378 Species:Mus musculus
Sequence 2:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster


Alignment Length:287 Identity:63/287 - (21%)
Similarity:96/287 - (33%) Gaps:100/287 - (34%)


- Green bases have known domain annotations that are detailed below.


Mouse    73 QHQPQQQQHHHHHHQHQQAQPQQTVPQQAQTQQVLIPASQQ--ATAPQVI--------------- 120
            |.|||.|.|.|.|    ...|:..||.|: ||.::...|.|  .|:.:::               
  Fly   103 QSQPQLQSHAHPH----PPPPRPLVPPQS-TQDLISTVSSQLDETSSELLGRIPATRSPSPVSMR 162

Mouse   121 -------VPDSKLLQHMNAS--------------SITSAAATAATL----ALPAGVTPVQQLLTN 160
                   .|||.|...::.|              .:.|..|....|    |:|..|..:|..:  
  Fly   163 DLHSPSPTPDSGLADLLDVSVDSGSSAHTQGIEADLISGVAGGVRLDNPFAVPTAVPNIQAAV-- 225

Mouse   161 SGQLLQVVRAANGAQYILQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQP 225
                               |..:..::|   |...|....||...   || ||..:||     :|
  Fly   226 -------------------PLPATPIKQ---PPRPPPPRPAPPRP---AP-PGQAAPQ-----RP 259

Mouse   226 QQILFTGNKTQVIPTT--------VAAPAPAQAPMPAAGQ------QQPQ---AQPAQQQAPLVL 273
            ...|...|.....|..        ..|..||:.|.|.:.:      :||.   :|||.:  |.:|
  Fly   260 PPPLAAVNPPPAAPEADDLLDMFGTTACKPAKPPPPKSKEDILSLFEQPHVPLSQPASK--PDLL 322

Mouse   274 QVDGTGDTSSEEDEDEEEDYDDDEEED 300
            . |...:|..|.:..|:|:.|.::..:
  Fly   323 H-DDLDETIGEGEPPEQEEPDTEQSNE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gtf2a1NP_113568.2 TFIIA_alpha_beta_like 10..>60 CDD:199899
TFIIA 13..378 CDD:281188 63/287 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..108 14/34 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..331 17/63 (27%)
TFIIA_alpha_beta_like <318..378 CDD:199899
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603
AP_MHD_Cterm 897..1219 CDD:299401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1533
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.