DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP3 and Decay

DIOPT Version :9

Sequence 1:NP_001341706.1 Gene:CASP3 / 836 HGNCID:1504 Length:277 Species:Homo sapiens
Sequence 2:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster


Alignment Length:302 Identity:103/302 - (34%)
Similarity:167/302 - (55%) Gaps:35/302 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     1 MENTENSVDSKSIKNLE-----PKIIHGSES-MD------SGISLDNSYKMDYPEMGLCIIINNK 53
            |::|:.|:..:..|:.:     .||.|...| :|      |..:.:::|: :....|:.:|:|:|
  Fly     1 MDDTDFSLFGQKNKHKKDKADATKIAHTPTSELDLKRIIISRPTNEDTYE-NCARAGIALILNHK 64

Human    54 NFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVL 118
            :.   .|...|.||:.|..::..|.:...::||..:|||..||.:.:::|::||||:...||..:
  Fly    65 DV---KGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVAREDHSQNDCFVLAV 126

Human   119 LSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE-------TDS 176
            :|||.||.::..:....::::.|.|.||.|::|..|||||.||||||..|:..:|       |..
  Fly   127 MSHGTEGKVYAKDMSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAVEFSSFAVMTRE 191

Human   177 GVDDDMAC-----HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYA-------DK 229
            .|.:..|.     :.||..||.|..|||...::|:||..||||||||||.:|.|.|       :.
  Fly   192 LVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEG 256

Human   230 LEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTK 271
            :|.:.:||.||||||.|::|.:.:...:..|::|..:|.|||
  Fly   257 VELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP3NP_001341706.1 CASc 37..277 CDD:214521 93/254 (37%)
DecayNP_477462.1 CASc 54..302 CDD:237997 92/248 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.