DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP3 and Strica

DIOPT Version :9

Sequence 1:NP_001341706.1 Gene:CASP3 / 836 HGNCID:1504 Length:277 Species:Homo sapiens
Sequence 2:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster


Alignment Length:285 Identity:78/285 - (27%)
Similarity:122/285 - (42%) Gaps:65/285 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    17 EPKIIHGSESMDS--------GISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAAN 73
            :||:...::|.|:        ||| .:|...:..:.....|.|::.|......  |.|:..|...
  Fly   278 KPKVTAVAQSQDAQGTISTSLGIS-KSSLTKNKLKPARVYIFNHERFDNKNEF--RKGSAQDVKV 339

Human    74 LRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHG---------------E 123
            ||.||..||.:|....|.|...|.:.:|.:..:|...:|:.|.|:||||               :
  Fly   340 LRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSALVLVILSHGTRHDQIAAKDDDYSLD 404

Human   124 EGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC---GIETDSGVDDDMACH 185
            :.::|    |:           .|.|:|..||||..:|||:|   ||   |..||:...:..   
  Fly   405 DDVVF----PI-----------LRNRTLKDKPKLIFVQACKG---DCQLGGFMTDAAQPNGS--- 448

Human   186 KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESF 250
              |.|  .|..|||..|:.|:| ::||:.|||:||..|.:.....:...|:..|.:.|..:.:. 
  Fly   449 --PNE--ILKCYSTYEGFVSFR-TEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQVVKMQSKD- 507

Human   251 SFDATFHAKKQIPCIVSMLTKELYF 275
                     :|||.:.|.||.:..|
  Fly   508 ---------RQIPSVTSTLTSKYVF 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP3NP_001341706.1 CASc 37..277 CDD:214521 70/257 (27%)
StricaNP_001260718.1 CASc 311..523 CDD:294037 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.